KEGG   Sclerotinia sclerotiorum: SS1G_05778
Entry
SS1G_05778        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K14026  SEL1 protein
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SS1G_05778
SSDB
Motif
Pfam: Sel1 WD40 Nucleoporin_N
Other DBs
NCBI-GeneID: 5489454
NCBI-ProteinID: XP_001592856
UniProt: A7EKD1
Position
Unknown
AA seq 1111 aa
MYRFFASDIFEVQSTEPTYIYDIIPVAAGLASISSDDCLRLLDPTALNGQPLNTIKKVNS
DVTCLKTIGSDESSIVVTAGRDGKVCLIDPRTGGKVGEVKSAAPVVQYVESHSDDVTELQ
FHPTQESLLLSGSTDGLVNIYNITITDEEEALHQTINHGHSIHHANFLSDTNIFALSHDE
KFSMYELVTNPEEGVEEPAPVVYGDMRGNLGGEYVANVLCRPDGGAVLGIGSHSKNEFDL
VRLKKGKPWVFAPETKVTLSGAHGSEIVRSFCFLDSHRAVLTAVIWQFVFQICYAQAHEE
ELGASLTAEESPKPSFHAQPSTAQESHRAPIVKNTAVDKAIHSLQRYERSHPRPTSSPSG
IVKTLTQYVVASLPRLVQGPPPDGKIPVHHQAPGPVAEAVQLLEQAAHVNNSDAIYLLAQ
INFYGNYSYPKDYSEAFRRYHQLASLDGNSSAQHMIGFMYATGIGGAVEQDQAKSLLYHT
FAAEGGSTRSAMTLAFRHHSGIGVPRSCDLAIKYYKEVADRAVEWYRSGPPGGMAYVQDS
YQLADEDGGIYGEGASFSSAGQNAKSGGPSSDAHAALDDVLEYLDLMSRKGDFKATFSLG
RIHYDGQKGLPRNLKSAKWYFTKVAKLYWTRSGKIIENDKPQLDKIAAKSAGYLGRMYLR
GESVDQSYEKAQTWFERGIKNGDSGSQYGMGLMYLHGLGVPKNSVLAQQYFKASADQDYA
PAQVSLGAMYLDQGTDNDIKVANRYFELAARYGNIEAYYYLADLINQGVGRDRSCNLATA
YYKNVAEKAEPLLTSFAEANNAYEQGDYELALIGYMHAAEQGYEKAQSNVAYIIDEQKSK
LTIPYWLTLVSTPRPKLLQNSKLALLYWTRAAKQANVDALVKMGDYYLYGIGTPVDLEKA
AACYTAASEFPQSAQALYNLGWMHENGVGLDQDFHLAKRYYDHALETNEEAYLPVTLSLL
KLRIRSAWNSFTHGKVNSIIDEPTPRKQWSLAEWISNFLQDDHPYYADYDADDAYGSVHD
PMPGGDADGLYDDILDDGLVESLIIIGLAAALVFLIVYRQQRQEAHRIGEGAAANAQQNA
QPLNGEVPNRGLFPRPGDANFNDWVAGGVGH
NT seq 3336 nt   +upstreamnt  +downstreamnt
atgtacagatttttcgcctcagatatctttgaagtacagagtacagagccgacatatatc
tatgatatcatacctgtcgcagctggccttgcatctatttcatcagatgattgcctgcgg
ttgctagatccaactgctttgaatggccagccattgaatactatcaagaaagtaaattct
gatgttacgtgtttgaaaaccattgggagtgatgaaagttctattgtggttacggctgga
agggatggaaaagtgtgtcttattgacccaaggactggtggaaaggttggagaggttaag
agtgctgcaccagtcgtgcaatacgtggaaagtcacagtgacgacgttacagaactacaa
tttcatccaactcaagaatcacttctgttatctggctctacggacggtctggtcaatata
tacaatatcaccataacagacgaggaagaggcccttcatcagactatcaaccatggtcac
tccatacatcacgccaactttcttagcgataccaacatcttcgctctttcacatgatgaa
aagttctctatgtatgaactagtaacgaatccagaagagggggttgaagagccagctcct
gtggtatatggtgatatgagggggaatctgggaggcgagtatgttgcgaatgttctgtgc
agacccgatggaggagctgtattaggaattgggagtcacagtaagaatgaatttgatctt
gtacggttgaagaagggaaagccttgggtatttgctcctgagacaaaggttacactttct
ggggctcatggatcggagatcgttagatcgttttgctttcttgattcgcaccgagctgta
ttgactgctgttatttggcagtttgttttccaaatatgttatgcgcaggcacatgaggaa
gagctaggggcatctctgacggcggaggagagtccaaagccatcttttcatgctcaacca
tctacagctcaagaatcgcatcgagcacccatagttaaaaatacagccgtcgacaaagct
atacattctctccaacgttacgaacgatcgcatccacgccctacctccagcccttccgga
attgttaaaacattgacgcaatatgttgttgcaagtcttccaagattggtccaaggacca
cccccagatgggaagattccagtgcatcaccaagctccaggcccagtcgcagaagcagtg
cagctcttggagcaagcagcccacgtcaataactccgatgcgatctatcttctagcgcaa
ataaatttctacggaaactactcatatcccaaggactatagcgaggcattcagaagatat
catcaattggcatcattggacggaaacagctcggcacagcacatgattggatttatgtat
gcgacaggaattggaggagcggtagagcaggaccaggcaaagtctttgctctaccataca
ttcgccgccgaaggaggaagtacaagatccgcgatgacccttgctttccgccatcatagt
ggaattggtgtgccgagaagttgcgatttggcgattaaatattacaaggaagtagcggat
agagcagttgagtggtatcgatccggtccgccaggaggtatggcatatgttcaagactcg
tatcagcttgcagatgaggatggtggaatctatggtgaaggagcaagttttagtagtgct
ggacaaaatgcaaagagcggagggccaagctcagatgctcatgcagcattagatgatgtt
ctcgagtatcttgacttgatgtctagaaaaggcgactttaaggcaacatttagcttgggg
cgtattcattatgatggtcaaaaaggtcttccgcgaaatttgaagagtgcgaaatggtat
ttcacgaaagtagccaaattatattggacgagaagtggaaaaatcatcgagaacgataaa
cctcaactagacaagattgctgccaaatccgcaggctatctaggacggatgtacctcagg
ggggagagtgtggaccaaagctatgaaaaggctcagacttggtttgaacggggtatcaaa
aatggcgattctggttctcagtatggaatggggttgatgtacctgcatggtcttggagta
ccaaaaaattctgtattagcacaacaatacttcaaagcttctgctgaccaagactatgcg
cctgcgcaagttagcctaggggctatgtacttggatcaaggtactgataacgacattaag
gttgccaatcgatattttgaactggcagcacgatatggtaatattgaggcttactactat
ctcgccgacctcataaaccagggagttggacgagatcgaagttgtaacttggcaactgca
tactacaagaacgttgcagagaaggcagaaccacttctgacgtccttcgccgaagcaaac
aatgcctatgagcaaggcgattatgaattggctttaattggttatatgcacgcggcagaa
caaggatacgaaaaagcacaatcaaacgttgcatatataattgatgaacaaaagtcgaaa
ttgactataccttactggctgactcttgtatccaccccaagaccgaaattgttacaaaat
tcgaaacttgcgctgctctattggaccagagctgccaagcaggccaatgtagacgcttta
gtcaaaatgggtgattactatctttatggtatcggtaccccagtcgatttggagaaagct
gcagcttgttatacagcggcatctgagtttcctcaaagtgcccaagcattatacaattta
ggctggatgcatgaaaatggtgttggtcttgaccaggattttcatctcgcgaaaagatat
tatgatcacgctttggagacaaacgaagaggcatatttacccgtgaccctcagtttgtta
aaactacgcatcagaagtgcatggaattcgttcactcatggcaaggtcaattcgattatc
gatgaaccaactcctcgaaagcaatggtcattagcggaatggattagcaatttccttcaa
gatgatcacccatactacgccgattatgacgctgacgatgcttatggttcagtacatgac
cctatgcctggtggtgatgcggatggactttacgacgacatcctagatgatggattggta
gaaagtcttattattattggcttagcagccgcactggtgttcttgatagtatatagacag
cagagacaggaagcgcatcgaataggtgaaggagcagcggcgaatgcccaacaaaatgca
caaccgcttaacggagaagttccgaatagaggacttttccctaggccaggtgatgcgaat
tttaacgattgggtggccggtggagtaggacattaa

DBGET integrated database retrieval system