KEGG   Sclerotinia sclerotiorum: SS1G_07099
Entry
SS1G_07099        CDS       T01071                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00100  Steroid biosynthesis
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
Module
ssl_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SS1G_07099
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SS1G_07099
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 5487924
NCBI-ProteinID: XP_001591653
UniProt: A7EP50 A0A1D9Q634
Position
Unknown
AA seq 497 aa
MTPKKTTTVSKAAEPHGYEFGGPIGAFGISFGLPLLCYATTFLCNDISGCPVPSSLSPST
LTINSLKQEVGWPENGLAGLSSWDVFLKVVGYYFLSMVLHRILPGEEKLGVELASGGKLK
YKFNTWSSTMFTFALCAAGTIAQGADFPVWTFIYDNYLQILTANIIISYGLATYVYIRSF
SIKPGNPELRELAAGGHTGNMLYDWFIGRELNPRVTLPLLGEIDIKEFCELRPGLMGWLL
MDYAFVAHQYKTYGYVTDSILLITAFQTLYVLDSYWMENAILTTMDITTDGFGLMLSFGD
LVWVPFIYSLQARYLAVYPLSLGVLGTSGVLAVLGIGYYIFRSSNNEKNRFRTDPTDARV
AHLKYLETKSGSKLLISGWWGVARHINYAGDWIMAWSYCLPTGIAGYLINHSSVAPTSGQ
SLVDGSFVYSGPAVHTEVTQGAARGWGMIITYFYVVYFGVLLVHREMRDEEKCERKYGED
WKRYKEIVRYRIIPGIY
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgactccaaagaagactaccacagtctctaaagcggctgagcctcatggctatgaattt
ggtggaccaataggagcttttggtatatccttcggacttccccttctctgctacgcgacg
acgtttctctgcaatgatatttctggatgtccagttccctcctcgctctccccttcgacc
cttacaatcaacagtctaaaacaagaggttggatggccagaaaatggacttgcgggtttg
tcaagttgggatgtatttctcaaagtagtaggatactactttctaagcatggtcttgcat
aggatcttgccgggcgaggaaaagctaggtgttgagcttgctagtgggggaaagctcaaa
tacaagttcaatacttggtcttctacgatgtttacattcgctctatgcgccgcaggaact
atcgcccagggagcagatttcccagtctggacttttatctacgacaattacctacaaatc
cttacagccaatatcatcatctcctacggtcttgccacttatgtatatatccgcagtttt
agcatcaaacctggcaatcccgagctccgcgaattggctgctggaggtcataccggaaat
atgctatacgattggtttattggacgtgaactcaacccaagagtaactctccctttactt
ggcgagattgatatcaaggaattttgtgagctacgaccaggtcttatgggatggctttta
atggattacgcatttgttgcccatcaatacaagacttacggatacgttaccgatagtatc
ttgctaattacagccttccaaacactgtatgtgcttgattcatattggatggaaaatgcc
atcctcaccaccatggatattaccactgatgggtttggactcatgctatcatttggagac
ttggtctgggttccattcatctattctctccaagcacgttacctagccgtttaccccctt
tctcttggcgttcttggcaccagcggtgtcctcgctgttctaggcatcggatattacatc
ttccgtagttccaacaacgaaaagaaccgcttcagaaccgacccgacagatgcccgtgtc
gcacaccttaaatacctagagacgaaatccggctccaaacttctcatttcgggctggtgg
ggtgtagctcgtcatatcaactatgctggtgattggattatggcttggtcttactgtctt
cccaccggtatcgctggctatctcatcaatcatagctcggtagctcccacatcaggccaa
tctctcgtcgacggttcatttgtgtatagtggaccagcagtgcacacggaagtcacacaa
ggggcagctagaggctggggaatgatcattacatatttctatgtggtttactttggtgtc
ttgttggtgcatagagaaatgagggatgaggagaaatgcgaaagaaagtacggtgaggat
tggaagaggtataaggagattgtcaggtacagaattatcccgggaatctattaa

DBGET integrated database retrieval system