KEGG   Sclerotinia sclerotiorum: SS1G_07184Help
Entry
SS1G_07184        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00052  Galactose metabolism
ssl00500  Starch and sucrose metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SS1G_07184
   00500 Starch and sucrose metabolism
    SS1G_07184
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SS1G_07184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 5488170
NCBI-ProteinID: XP_001591738
UniProt: A7EPD5 A0A1D9Q5V5
Position
Unknown
AA seq 551 aa AA seqDB search
MFRLTSLAGALLVAVSNAASSAPTAVPTDAPIPGDYTGALRPQIHYSPPKDFMNDPNGLF
RDADGVYHVYYQYNPTATVAGNQHWGHATSKDLYHWDNQKIALFPENDSEGIFSGSAIVD
VNNTSGFFPNQTNGVVAIYTLNTPESETQNIAYSFDGGYTFEKYAENPVIPSTSTQFRDP
QVTWFEDHWVMVVAYSRAFEIGIFTSPDLKEWTATSNFSHHGLLGLQYECPNLIPIPVAD
GNGDENLHLLIISINPGAPLGGSTTQYFPGTFNGTHFTPLDSATRLLDFAKDNYAGQFFN
GIPADEDPVFLGWASNWEYGQQVPTGELEGWRSSMTLPRRTHLANVTRTGWALISYPYDM
TPLYNESAPLASNDNLGNGSLIVDYSSVSSGAIYISCKVHSMPNNTLAQGTLNFTFFSST
TRESVSGGIFLGGDAPVWLSRRNFNGFAETNPFFTDRFSVGNTINDQGTFQFDVVIDRSI
LEVFVDGGRSSGTITFFPEGILDTVEVRAGDLNVGVVVDAKIYGLDGAWSDMASADGIVY
GNVTTTTTAAN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcttacttctctagctggtgcccttctggtcgcggtatccaatgctgcatca
tctgctcccaccgctgttcccactgatgcacctatcccaggtgattataccggagcatta
agacctcagattcattattcgccacctaaagatttcatgaatgatccaaacggactgttc
agagatgcagatggagtttatcacgtctactatcaatacaacccaacggcaactgtagca
ggaaaccaacattggggtcatgcaacatcaaaggacctctatcactgggacaatcaaaag
atcgcactcttccctgagaatgacagcgaaggaattttcagtggaagtgcaatcgttgat
gtaaacaacacatccggtttcttccccaaccaaaccaacggtgtagttgcaatctacact
ctcaacactcctgagtcggaaactcaaaacatcgcctactccttcgatggtggttacacc
tttgagaagtatgccgagaaccccgtcatcccatctacctctacccaatttcgtgaccct
caagtcacatggttcgaagatcattgggtcatggtagtcgcctattcccgcgcctttgag
atcggtatcttcacctcccctgatcttaaagaatggactgccacctccaatttcagtcat
cacggtctgcttggtttacaatacgagtgtccaaatctgatccccattcccgtcgccgac
ggtaacggtgatgaaaacctgcatctcttaatcatctccatcaatccaggtgctcctctt
ggtggttccaccacccagtacttccccggtacattcaacggaacccatttcaccccactc
gattccgcgacccgcctcttagactttgcaaaggacaactacgccggtcaatttttcaac
gggattcctgcagatgaagacccggttttcttgggttgggctagcaactgggaatatgga
caacaagtacccaccggagaactcgagggatggcgcagttccatgaccctaccccgccgt
acccatctcgcaaacgtaacccgcacaggctgggccctaatctcatacccctatgacatg
acccctctctacaacgagagcgcaccactcgcctccaacgacaacctcggaaacggtagc
ctcatcgtcgactactcctccgtctccagcggcgccatctacatctcctgcaaggtccac
agcatgcccaacaacaccctcgcccaaggaaccctcaacttcaccttcttctcctccacc
acccgcgaatccgtctccggcggcatattcctcggcggcgacgcccccgtctggctctcc
cgccgcaatttcaacggattcgccgaaacaaaccccttcttcaccgatcgtttctccgtc
ggaaacaccatcaacgaccaaggaaccttccaattcgacgtcgtgatcgatcgatccatc
ctcgaggtattcgtcgacggtggccgaagcagcggcaccattacctttttccccgaaggc
attttagataccgtggaagtgagagctggagatcttaacgtaggcgtcgttgttgatgct
aagatttatggtttggatggtgcgtggagtgatatggctagtgctgatggtattgtttat
ggtaatgtgacgacgacgacgacggccgccaactaa

DBGET integrated database retrieval system