KEGG   Sclerotinia sclerotiorum: SS1G_09858Help
Entry
SS1G_09858        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00500  Starch and sucrose metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SS1G_09858
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     SS1G_09858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectate_lyase_3 End_N_terminal
Motif
Other DBs
NCBI-GeneID: 5485339
NCBI-ProteinID: XP_001589225
UniProt: A7EWZ9 A0A1D9PT34
Position
Unknown
AA seq 783 aa AA seqDB search
MILFTTLWIIFGLISSCFGQAYWYETIAHQGVAPYNPQGSAYQVFRNVKDFGATGNGVTD
DTAAINAAIAYGSRCVEGAAGVGCASATNSPAVVYFPAGTYLISSPILPYYMTQLVGNPN
ALPTIKATAGFVGLALIDADPYGSSVPDYGTTNVFYRQVRNFIIDTRNMPATSLARGIHW
PTAQATSLQNMVFNLNTASGNLHQGVFIENGSGGFLNDLIFNGGQYGMNVGSQQFTSRNL
TFNNCETAIYQLWDWGWTYMGLSINNCGTGLDMSDGGSSAQQVGSITVIDSTFSNTPIGI
LTARSSTSLPLTAGSLAIENVIFTNVPTAVEGPNGVSLAGSTGSITVAAWVQGNTYSPTG
PNSTQGATSAFPRPASLLSGTRYYARSKPQYNTLAATQFSSVRTAGAKGDGVTDDSAALQ
AIITSATAAGKLIYFDSGIYKVTTTITIPAGARIVGETYPVIMGSGSFFSNMNAPQPVVR
IGSTAGETGVVEWSDMIVSTQGATSGATLIEWNLASPSTTPSGIWDVHTRIGGFDGSDLQ
VAQCPTTGTQPNANCIAAFMSMHVTSTASGLYMENVWLWTADHDIDDVDDTQISIYTGRG
LSVESTTGNFWLIGTAVEHHSLYQYQFANTKNVFMGYIQTETPYYQPVPQATSPFPPVTT
LNDPDFATFCAGKGPTCYDAWGLRILDSQDILVYGAGFYSFFDNYSLSCSNHTATTYNSN
CQTQIFGIDEGGSAMESCTGSTVFVYGLNTLGVESMIDMDGESIAGYTSNGNVYGANVVR
FVS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgattctctttactacactttggatcatttttggtcttatttcttcatgtttcggtcaa
gcttattggtacgaaacaattgctcatcagggagtcgctccttataatcctcaagggagt
gcatatcaggtatttaggaatgtgaaggattttggagctacaggaaacggtgtcacggat
gatacagctgcgattaatgccgcaatcgcatatggttcccgatgtgtggaaggagctgcg
ggtgtcggatgtgcatctgcaactaattcaccagctgtggtgtatttccctgcaggaaca
tacctcatttcatctcccattcttccatactacatgactcaattagttggaaacccaaat
gcgttaccaaccatcaaagctacagctggatttgtaggtctagcacttatcgatgcagac
ccttatggatcatctgtaccagattatggcactacaaatgtattctatcgtcaagttcga
aattttatcattgatactagaaatatgccagctacttctttggcacgaggtattcattgg
cctacagctcaagcaaccagtcttcagaatatggtctttaacctcaataccgcaagtggt
aacctgcatcaaggagtctttattgaaaatggttctggtggatttttgaatgatcttatt
tttaatgggggtcaatatggtatgaatgtcggttcacaacagtttacttcaagaaactta
acatttaataattgtgaaactgccatatatcaactttgggattggggttggacatatatg
ggcttatcaatcaacaattgtggtactggtcttgatatgtctgatggaggttcttcagca
caacaagttggatccataacagtcattgacagcactttttctaatacacctattggtatc
cttactgctcgaagtagtacatcacttcctcttactgccggaagtctggctatcgaaaat
gtcatcttcaccaatgtccccaccgcggtagaaggaccaaatggtgtatctctagcagga
agcactggatcaatcaccgttgctgcttgggtacaaggtaacacctacagtcccacaggt
ccaaactctacccaaggtgcaacttcagcctttcctcgtcctgcatccttgctcagtggt
acaaggtattatgctcgatctaagcctcagtataatactctcgccgcaactcaattttct
agtgttcgaacagctggagctaagggtgacggagtaaccgatgattctgctgctctccaa
gcaatcatcacttctgcaacagctgcagggaaattaatatattttgattccggtatctac
aaagtaacaaccacaatcacaatcccagctggagcccggatcgtcggtgaaacttaccct
gtaataatgggctctggctccttcttcagtaacatgaacgctccccaacccgtcgtccga
atcggctctacggctggcgaaacaggagtcgtagaatggtccgacatgatagtatcgact
caaggcgctacatctggagcaacactaattgaatggaatctcgcctccccatctacaact
ccatccggaatttgggatgttcacacacgaattggtggattcgatgggagtgatttacaa
gttgctcaatgtcctactacgggtactcaaccgaatgcaaattgtatcgcggcgtttatg
agtatgcatgttactagtactgcgagtggattgtatatggaaaatgtttggttgtggact
gctgatcatgacattgatgatgtggatgatactcagattagtatttatactggaagggga
ttatctgttgagagtactactgggaatttttggttgattggaacggcagtagagcatcat
tctctctatcagtatcaatttgcgaataccaaaaatgtattcatgggatacattcaaacg
gaaactccatactaccaacctgttccccaagcaacctcaccctttccaccagtcaccacc
ctcaatgaccccgatttcgctaccttttgcgctggaaaaggtcctacttgttatgatgca
tggggattacgaattttagattcccaagatattttagtatatggagctggattttatagt
ttctttgataattatagtctttcatgttccaaccacacagccacaacctacaacagtaac
tgccaaactcaaatcttcggtattgatgaaggtggctccgcaatggaatcgtgtactgga
agtacggtgtttgtatatggattgaatacgttgggggtggaaagtatgattgatatggat
ggggagagtattgctgggtatacgagtaatgggaatgtttatggggcgaatgttgttagg
tttgttagttaa

DBGET integrated database retrieval system