KEGG   Sclerotinia sclerotiorum: SS1G_12214Help
Entry
SS1G_12214        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K14565  nucleolar protein 58
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    SS1G_12214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ssl03009]
    SS1G_12214
Ribosome biogenesis [BR:ssl03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    SS1G_12214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT Cas_Cas1 YL1
Motif
Other DBs
NCBI-GeneID: 5483263
NCBI-ProteinID: XP_001587184
UniProt: A7F2R6 A0A1D9Q393
Position
Unknown
AA seq 570 aa AA seqDB search
MAPLFILTETAAGLVLFKADKKLLKKDDVASEIETAEGINGLLKLKQFQKFDSAATALEE
VASLVEGKVSPMLAKLLDTLKDEKKASLAVADPKLGQAINKLPGLTLTPISDSKTNDIFR
GIRDHLPSLIPGLLPEHISTMSLGLSHSLSRHKLKFSPDKVDTMIVQAISLLDDLDKELN
TYAMRVKEWYGWHFPEMGKIVNDNLAYARVILKVGMRVNTSSTDLADILPEEIEAAIKAA
AEVSMGTEITEEDLDNIKLLAEQVVGFTEYRQQLSSYLSARMQAIAPNLTELVGELVGAR
LIAHAGSLMNLAKSPASTIQILGAEKALFRALKTKHDTPKYGLIYHASLVGQATGKNKGK
IARMLAAKAAIGLRVDALSDWSAQGEGKGDDVDDEERSALGVTSRAKIERHLRGIEGKPL
LPRGVAVGPNGKTTSAPGKWEVKEARKYNADADGLAGDEPAAAIPVREKKNKKLIEEVAE
KSDSDSSDESDASEKKSKKGDKEAKKAEKAAKKAEKAAKKAAKAAKKAVKEAKEVKKSAV
NDTPEVNGKKRKSEDDGEKSEKKKKKKNKD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctttatttattcttacggagacggcggctggattggttttatttaaggccgat
aaaaagcttttgaagaaggatgatgtcgcttcagaaattgaaaccgctgaggggatcaat
ggattattgaagcttaagcaattccaaaagttcgacagtgccgcgacagctttggaggag
gttgcttcgttggtcgagggaaaagtttcacctatgcttgcaaaacttctcgacacttta
aaggatgagaagaaggcgtctctggccgttgctgaccctaaattgggacaagctatcaac
aaactccctggtttgactctcacaccaatctccgactcgaaaacaaatgacattttccgt
ggaatccgcgatcacctcccctccttgatcccaggtctcctccccgaacacatctccact
atgtcactgggtttgtcgcattctttgtcgcgccacaagctgaagttctcacccgacaag
gttgataccatgattgtgcaagctatttcgttgttggatgatttggacaaggagctcaac
acatacgctatgagagtaaaggaatggtacggatggcatttcccagaaatgggcaagatt
gtgaacgacaatttggcctacgctagagttattttgaaggtcggtatgcgcgtgaacact
tcaagtaccgatctcgcggatattctcccagaagaaattgaggctgccatcaaagctgct
gctgaagttagtatgggtactgaaatcactgaagaagatttggacaacatcaagcttttg
gcagagcaagtcgtcggctttacagaatatcgtcagcaattgtcaagctacttgtctgca
cgtatgcaagcaattgcccccaacttgaccgagttggttggcgagttggtcggggctcga
ttgatcgctcacgctggatctcttatgaacctcgccaagagccctgccagtaccatccaa
attcttggtgctgaaaaggctctattcagagcccttaagacgaaacatgacactccaaaa
tacggtcttatctaccatgcttcgctggttggtcaagctactggaaagaacaagggaaag
atcgcgcgtatgttggccgccaaggcagctattggactgcgcgtcgatgctttgtcagac
tggagtgcacaaggtgaaggcaaaggtgatgatgttgacgatgaagagagatccgcactg
ggtgtcacttcacgtgctaagattgaacgtcatctccgaggcattgaaggaaagcctctc
cttcctcgtggtgttgctgttggaccaaatggcaagacaacttcagctcctggtaaatgg
gaagtcaaggaagcccgaaaatataacgcagatgcggatggtcttgctggggatgagcca
gccgctgctatcccggtgagagagaagaaaaacaagaaactcatcgaggaagttgctgag
aagtctgattctgactcttcagacgagagcgatgcctctgaaaagaaatctaaaaaggga
gacaaggaagccaaaaaggctgagaaggctgccaagaaagccgaaaaggctgcgaagaag
gccgcaaaagcagctaagaaggcagtaaaggaagcgaaggaagtaaagaagagtgccgta
aatgacacacccgaagttaatggaaagaaacgaaagtcagaagatgatggcgaaaagtcc
gagaaaaagaagaagaagaagaacaaggattga

DBGET integrated database retrieval system