KEGG   Sclerotinia sclerotiorum: SS1G_12886Help
Entry
SS1G_12886        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00030  Pentose phosphate pathway
ssl00480  Glutathione metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Module
ssl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ssl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SS1G_12886
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SS1G_12886
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssl04147]
    SS1G_12886
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SS1G_12886
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SS1G_12886
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SS1G_12886
  Exosomal proteins of colorectal cancer cells
   SS1G_12886
  Exosomal proteins of bladder cancer cells
   SS1G_12886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 5482288
NCBI-ProteinID: XP_001586308
UniProt: A0A1D9PUU0 A7F5K8
Position
Unknown
AA seq 511 aa AA seqDB search
MADTVIKPEESGNAGSLELKDNTVIIVLGASGDLAKKKTFPALFGLYRNQFLPKDVRIIG
YARTKMDHEEYIKRVRSYIKTPTKDMEQQLQEFCDICTYISGQYDKPEGFIELRKHCEEF
EKGRKEANRIFYMALPPSVFTTVSQQLKANTYPETGVARIIVEKPFGKDLGSSRELQKAL
EPNWKEDEIFRIDHYLGKEMVKNILILRFGNEFFGATWNRNHIDNVQITFKEPFGTEGRG
GYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSAEDVRDEKVRVLRGIPAIEPKNVIIGQ
YGKSLDGTKPSYKEDDTVPKDSRCPTFCAMVAYIKNERWDGVPFILKAGKALNEQKTEIR
IQFKDVTSGIFKDIPRNELVMRIQPNESVYIKMNSKLPGLSMQTVVTELDLTYRRRFSDL
KIPEAYESLILDALKGDHSNFVRDDELDASWRIFTPLLHYLDDNKEIIPMEYPYGSRGPA
VLDDFTSSYGYKFSDAAGYQWPTTQTAPNKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggccgacactgttatcaaaccagaggagtctggcaatgctggatctctcgagctgaaa
gacaacactgttatcattgtattgggggcatccggtgatcttgcaaagaagaagacattc
ccagctcttttcggtctctatcgtaaccagttccttccaaaagatgtcagaatcattgga
tatgcgcgaacaaagatggaccacgaggaatatattaagagagttagatcatatatcaag
actcccaccaaagatatggaacaacaacttcaagaattctgcgacatctgcacatacatt
tccgggcaatacgataagccagagggttttatcgagttacgaaaacactgcgaagagttc
gagaagggaagaaaagaggccaacagaatcttttacatggctttacctccgtctgttttc
actactgtttcgcaacaattgaaagcaaacacttacccagaaactggcgttgcaagaatc
attgttgagaagccatttggaaaggatttgggaagttcccgcgagttgcaaaaggcattg
gagccaaactggaaggaagatgagattttccgtattgatcattacctcggaaaggagatg
gttaaaaacattttgattttgagatttggtaacgaattttttggtgctacatggaacaga
aatcacattgataatgttcaaattacattcaaggagccttttggaactgaaggccgagga
ggttattttgacgaattcggtatcattcgagatgtcatgcaaaaccatcttctacaagtc
ctcaccctcctcgctatggagaggccaatttcattctctgctgaggatgttcgtgacgag
aaagtccgagtccttcgtggtatcccagcaatcgaaccaaagaatgtcatcattggtcaa
tatggcaaatctttagatggaactaagccttcttacaaggaagatgacacagtaccaaag
gattcaagatgcccaacgttctgtgctatggtcgcatacatcaagaacgagcgatgggat
ggtgtaccatttatcttgaaggctggtaaggctcttaacgaacaaaagaccgagatcaga
attcaatttaaggatgtcacctctggtatcttcaaagatatcccaagaaacgagcttgtc
atgcgcattcaaccaaacgagagtgtctatattaagatgaactccaagttgccaggtttg
agcatgcaaactgtcgttaccgaactcgatttaacttaccgccgccgattctcggatctt
aagatcccagaagcatacgaatccctcattctcgatgctcttaagggtgatcactccaac
tttgttcgtgatgatgaacttgatgcaagttggagaattttcacaccactcttacattac
cttgatgacaacaaggagattattcctatggaatatccatacggctctcgtggacctgct
gtcttggatgacttcacatcttcttacggttataagttcagtgacgcagctggttatcaa
tggccaactacacaaaccgctcctaacaagctctga

DBGET integrated database retrieval system