KEGG   Sclerotinia sclerotiorum: SS1G_14022Help
Entry
SS1G_14022        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00051  Fructose and mannose metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SS1G_14022
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SS1G_14022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N DUF3842
Motif
Other DBs
NCBI-GeneID: 5481092
NCBI-ProteinID: XP_001585162
UniProt: A7F8U1 A0A1D9QG65
Position
Unknown
AA seq 389 aa AA seqDB search
MGLKAVHFGAGNIGRGFVAEFLHKSGYEVVFCDVMDSIIQKLQTTPSYKVIQVGAEGTSE
DTITNYRAINSKTHEADVIEEIRTADVVTCSVGPNILKFIAPVIAKGIDGRSNDATPIAV
IACENAIGATDTLANHIKGDHTPQERLDDHHQRARYANSAIDRIVPAQDPDAGLDVKLEK
FYEWVVDRTPFSDHEPPAIQGIKWVDDLIPYIERKLFTVNTGHAAAAYHGYYHQKATVYD
ALQDPNILKEVHAALEETSRLIVGKHGIEAQEQKDYVDKIITRIGNPHLEDAVERVGRAP
LRKLSRKERFIAPAAELAEEGKDFTALLDAAEMAFRFQNVEGDEESKELAKIMSENSAEQ
VVEKVCGLQSDHPLFPHVVAVVKKVQADE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgaaagcagttcatttcggcgccggcaatatcggtagaggttttgttgctgaa
tttcttcacaaatccggttatgaagtcgtcttctgtgatgtcatggacagcattatccag
aaattgcaaaccaccccttcatacaaagttattcaagttggagcagagggaacaagcgaa
gataccattaccaattatcgcgccataaactcgaaaacacatgaagccgatgttattgag
gagattcgtacagcggatgtagtaacttgctccgttggtccgaatattctcaagttcatt
gctccagttatcgccaagggtattgatggccgctccaatgacgctaccccaatcgcagtc
attgcttgcgagaacgcgataggtgcaactgatactctcgccaaccacatcaaaggcgac
catacccctcaggaacgtttagatgatcatcaccagcgcgcacgatacgctaactctgcc
atcgaccgtatcgttcccgcccaagatcctgatgcaggtcttgatgtgaagctcgagaaa
ttttacgaatgggttgttgatcgcacacctttcagtgaccatgaaccgccagccattcaa
ggtatcaagtgggtagatgacttaataccttacattgagcgtaaactcttcaccgtcaac
accggacacgcagctgctgcataccacgggtactaccaccagaaggccacagtctatgac
gccctacaagatcctaatattctcaaggaagttcatgctgcgctagaggagacgagcaga
ttaatcgttggcaagcacggtatcgaagcccaagagcaaaaagactatgtcgacaagatc
atcaccagaataggaaacccacatctggaagatgcagtagaaagagttggccgtgcaccc
ctgcgcaaattgagcagaaaagaacgattcattgcaccggcagctgaacttgcagaggaa
ggaaaggacttcactgcactattagatgctgctgagatggccttccgtttccaaaacgtt
gaaggtgatgaggagtccaaggagttggccaagatcatgtctgaaaactctgccgaacaa
gttgtggagaaggtctgcgggttacagtccgatcaccccttgttccctcacgtagtagcg
gttgtgaagaaggttcaggccgacgagtag

DBGET integrated database retrieval system