KEGG   Sediminispirochaeta smaragdinae: Spirs_0053
Entry
Spirs_0053        CDS       T01287                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm02010  ABC transporters
ssm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ssm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spirs_0053
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Spirs_0053
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssm02000]
    Spirs_0053
Transporters [BR:ssm02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Spirs_0053
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 GSH-S_ATP
Other DBs
NCBI-ProteinID: ADK79213
UniProt: E1R6T1
Position
57132..58085
AA seq 317 aa
MRKVVLILLCGMLLGGTLFAGGQGEGEKVLQVAATFGDLGNPFFFTMGKGVEDAAKAIDP
NAKVTVQSSGYDLNTQTSQMENFIANGVDIIILNAADTAGIAPAVRKAKEAGIIVVAADV
NADGGVDATVTSNNYQAGTQAGEYIVKRLGGKGNIVIINGPPVSAVIDRVNGAKEVLAKN
PGIKILSDNQNAGGNREGGLRVMTDLLTAYDNIDAVFAINDPTGIGADLAIKQAKRGDEM
FVVGVDGAPDAVVALNDTNSSFVATPSQDPYTMATRAVQVAYEVIQGNPPKEKLILIPTT
LITRDNVSEYKGWTEPE
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagaaaagtagtgctgatactgctttgtggcatgttgcttggcggaacactgtttgcc
ggtggtcagggagaaggtgaaaaagttcttcaggtggcggctaccttcggcgatcttgga
aatcccttcttttttaccatgggtaagggagtcgaagatgcagcaaaggcaattgatccc
aatgcaaaggtcactgtccaatcgtcgggctatgatctcaatactcaaaccagccagatg
gagaatttcattgcaaatggtgtggatattattatcttgaatgcggccgacaccgcagga
attgcacctgccgtacggaaagcaaaagaggctggtattatcgtggttgccgccgatgta
aatgcagatggcggagtcgatgcaacggttacctccaataattatcaggccggtacccag
gctggagaatacattgtaaagaggcttggggggaagggaaacattgtcattatcaatgga
cctcctgtatccgccgttatcgaccgggtaaacggagcaaaagaggttttagccaagaat
cctggaatcaagattctctccgacaaccaaaacgccggtggtaaccgtgaaggcgggctc
cgcgtcatgaccgatcttcttaccgcttatgataacattgatgcggtttttgccattaat
gatccaaccggtattggtgctgatttggcgatcaaacaggctaaacgcggtgatgaaatg
tttgttgtcggcgttgatggtgctcccgatgctgtggttgcgcttaatgacacgaacagc
tcttttgtagccaccccatcacaggatccgtacaccatggcgacgagggccgtgcaggta
gcgtatgaagtgatacaggggaatccccctaaagaaaaactgatccttatcccgaccaca
ttgattaccagggacaacgttagtgaatacaagggctggaccgaaccggaatag

DBGET integrated database retrieval system