KEGG   Sediminispirochaeta smaragdinae: Spirs_1812Help
Entry
Spirs_1812        CDS       T01287                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00900  Terpenoid backbone biosynthesis
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spirs_1812
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Spirs_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADK80938
UniProt: E1R6C0
Position
1957047..1957979
Genome map
AA seq 310 aa AA seqDB search
MVAVILSIMTLTIEAPAKINLHLQVGKLRSDGYHDLLSLMHLVDLSDRVSLRMEGKGGTV
ELEGNFDCRKEDNLLYKAASAYLQERQKRVPNASPAPGLTISCLKRIPAGGGLGGGSSDA
AALLKLLDRFFGAFPQKGVLDEIALSLGSDVPFFLHTGAEIAQGRGEVLEPVEPLPAYPL
VLVFPKWRISTPDAYASVDRLRREKADRPRSLSLEQLRESYSRPVAQWPFFNDFTSPVLL
QFPESRNLLLGLQNQGALFSQMSGSGSTFFGLFDGEKTALRAFERLKSMGYRCHLGKMLA
RPYDPVYNGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtagcggttatactatcgatcatgacactgacaatagaggctccggccaagataaat
cttcaccttcaagttggaaagcttcgttcggacggctatcatgaccttctcagcttaatg
cacctcgtcgatctttcagatagggtgagcctgcggatggaaggaaaagggggaacggtg
gagcttgaagggaatttcgactgccggaaggaggacaatttgctgtataaggctgcctcg
gcctatcttcaagaaagacaaaagagggtgccgaatgcttccccggctcctggtttgacc
atttcctgtttgaaaagaatcccggcggggggagggctcggtggaggatcatccgatgcc
gctgcgctattaaagctgcttgaccgttttttcggggcttttccccaaaagggggttctc
gatgagattgccctttctttggggagcgatgttccttttttcctccacacaggggctgag
atagcccagggaaggggcgaggtgctcgaacccgtggaacctcttcccgcttatccactt
gtgttggtatttccgaaatggaggatttcgactcccgacgcctatgcctcggtcgatagg
cttaggcgcgaaaaagcggatcgtccccgctccctttccctcgagcagttacgcgaatca
tacagcaggcctgttgcccaatggccttttttcaacgatttcacctccccggttctcttg
cagtttccagaatctcgtaacctccttttagggctgcagaaccagggggccctcttttcg
cagatgtctggaagcggttctacctttttcggactctttgatggggaaaaaacggccctt
cgggcctttgaaagactaaaatccatgggctatcgttgtcatcttggaaaaatgcttgcg
cgcccgtatgacccggtttacaatgggcgataa

DBGET integrated database retrieval system