KEGG   Sediminispirochaeta smaragdinae: Spirs_2729
Entry
Spirs_2729        CDS       T01287                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00230  Purine metabolism
ssm01100  Metabolic pathways
ssm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Spirs_2729
Enzymes [BR:ssm01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Spirs_2729
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ADK81833
UniProt: E1R8S6
Position
complement(2919363..2921729)
AA seq 788 aa
MAERYREMKIFEKEIAERGFRYVGQPLPNREAEMKAAGEIRYIDDLRMPGMLHAKILFSP
HAHARIVSIDTSKAEALDGVRAVVTWKDAPRIIFNSAMRFYMDTSPFDMPKTEYIFDDTV
RFVGDRVAAVAADDEFIAAQAIKLIDVEYEILPSVIRLEDAIQPDAVQANPYGVDGSNIC
GGRVAYGSHDEDEVLRAVEEAEYSFDDTFHTSRVHHGYMEPVTHIAHYTRDGKLTIWTSG
QNVFCFRDVIATSLGMKQSRVRVIKTVCGGAFGGKLEVMHEPVVALLSMKTLRPVKIRLT
RQENFMASRTRHEGILRIRTGVDKNGTIVAQHVESALNTGAYAGSGPNTVGAQSGKTFIL
YGAQKMFYSGASYYTNTPLAGAMRGYGCPQIMVTRETHTENIARALGYDPAEFRRMNVVK
PHHKNCMGNDMHNARIVDCIDRGVELFDWKRRRARAEDGNDGAQAIVHGIGMDVAVHGNG
WYPVYQDITTITLRMNNDGTATLLTGTHDLGTGAKTVLSQIAAEILTIPPGEIEIIEADT
DVTPLDLGAQASRTTYIGGNATIMAARNLRGQLIKEAASMLKVPKDRLELEECFVVDREE
PDTRVSFEDVVGSAQDGSAGNPQRELIATETFESLDSIDSYVAVFCEVEVNRQSGEVKVI
DLLSVHNSGKVINPATYEGQVHGGMHMGLGYALSEEMLIDSESGKVSNPTFKKYHMFRAS
EMPKIHVETVEDPEEAGPFGAKSIGECATDGIAGAVVNAVSHALGGVKLDRIPLTPEYIK
EVAAGNKS
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggctgaacgttatcgggagatgaagatttttgagaaggagatcgccgaacgaggtttc
cgctatgtgggtcagccccttcccaaccgggaggccgaaatgaaggctgccggagagatt
cgttacatcgacgatttgcgaatgccgggaatgcttcatgcgaagatcctcttttctccg
cacgcccatgcgaggatcgtttccatcgataccagcaaagccgaggcccttgacggggtg
cgggcggtggtgacctggaaggatgctcccaggattattttcaatagtgccatgcgcttt
tacatggatacaagtcccttcgacatgccgaagaccgagtatatcttcgacgatacggtc
cgttttgtcggggaccgggttgccgcagtggctgccgatgatgagttcatcgcggcccag
gcaatcaagctgattgatgtggagtatgaaatccttccgtcggtgatacgcctggaggat
gccatccagccggatgctgtgcaggccaatccctatggtgtggatggaagcaatatttgt
gggggcagggttgcctacggcagccacgatgaagatgaggtcctccgtgccgtcgaagag
gcggaatacagctttgatgatacctttcataccagcagggtccatcacggctatatggag
cctgttacccacatcgcccattacacccgggacggaaagttgacgatctggaccagcggc
cagaatgtgttctgttttcgggatgttattgccaccagcctcggcatgaaacagagccgc
gtcagggtcatcaaaaccgtctgcggcggcgctttcggcggaaaactcgaggtgatgcac
gaacccgttgttgcattgctctccatgaaaaccctgcgcccggtcaagatccgtctcacc
cggcaggaaaacttcatggcaagccggacccggcacgaaggaattctgagaattcgtacc
ggcgtagacaaaaacggcacgatcgttgcccagcatgtggaaagcgcgctgaataccggt
gcctatgccggcagcggtcccaacaccgtaggggcccagtcgggtaagacctttattctc
tacggtgcacaaaagatgttctattccggtgcaagctactacaccaatacccccctggcc
ggtgccatgcgcggttacggttgtccgcagatcatggtgacccgggagacccacaccgaa
aacatcgcccgagccctcggctacgatcctgccgaattcaggcggatgaacgtcgtaaag
ccgcaccataaaaactgtatgggcaacgatatgcacaatgcccgtatcgtcgactgcatc
gaccgcggtgtggagcttttcgactggaaacggcggcgggccagggccgaagatggtaac
gacggggcacaggccatcgttcacggcatcggtatggatgttgccgttcacggcaacggc
tggtatccagtctatcaggatatcaccaccattaccctgcgaatgaataacgacggtacg
gcaacccttctgaccggtacccacgacctaggtaccggtgccaaaacggtccttagccag
attgcggccgagattcttaccattcctcccggtgagatcgaaatcatagaagcggatacc
gatgtcacccccctcgatctcggcgctcaggcaagccgaaccacttatatcggcggaaac
gccaccatcatggctgctcgaaatctccggggacaactcatcaaagaggccgcttcgatg
cttaaggttccgaaagatcgccttgaactcgaggagtgctttgttgtggaccgggaggag
cctgatacacgggtaagctttgaggacgtggtcggctcggcccaggatggaagcgcggga
aatcctcagcgtgaactcatcgccaccgagacctttgagtctctcgattctatcgacagc
tacgtggcagtcttctgcgaggtcgaagtgaatagacagagcggagaggtaaaggtgatc
gatcttttgtcggttcacaattcgggaaaggtgatcaacccggccacgtatgaagggcag
gtccacggtggcatgcatatgggactcggctacgccctctccgaggagatgttgatcgat
tccgaatccggaaaggtttccaatccaaccttcaagaaataccacatgttcagggcctcg
gaaatgccgaaaattcatgtcgaaacggtagaagatccggaagaggctggccccttcgga
gcaaaaagcataggcgaatgtgccaccgacggcatagcaggggcggtggtcaatgccgtc
tcccatgccctgggtggggttaagctggacagaatacctcttactcctgagtatattaaa
gaggttgcggccgggaacaaaagctga

DBGET integrated database retrieval system