KEGG   Sediminispirochaeta smaragdinae: Spirs_2964Help
Entry
Spirs_2964        CDS       T01287                                 

Definition
(GenBank) protein of unknown function DUF1498
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ssm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spirs_2964
Enzymes [BR:ssm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     Spirs_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: ADK82066
UniProt: E1R3U5
Position
complement(3170221..3170895)
Genome map
AA seq 224 aa AA seqDB search
MKRSEINAIIEGAQAFFSEQGFHLPEWAFWNPEQWAAHKNGCKEIFDCKLGWDITDFGSG
RFETRGLTLFTLRNGLEGSYAKPYAEKIMVVGEEQETPFHFHWNKMEDIINRGGGKLAFE
LYMSDAQDGFSTQSVTVSVDGVQRVLEAGERLVLDPGSSLSLPQRLYHRFFAVKGYGKVM
CGEVSMVNDDDSDNRFKEELGRFPAIEEDVPPTRLMVGDYRRFA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaagtgaaataaatgcaatcatcgaaggggcgcaagccttttttagtgaacag
gggttccatctgcccgaatgggcattctggaaccctgaacagtgggccgcacataaaaac
ggatgtaaggaaattttcgactgtaagcttggctgggatatcaccgatttcggttcaggg
cgatttgagaccaggggactgaccctgtttaccctgagaaacggtcttgaagggagttat
gcaaagccctatgcggagaaaatcatggtggttggtgaggaacaggagactccctttcac
tttcactggaataagatggaggatatcatcaacaggggaggtgggaagcttgcctttgaa
ctctatatgtcggatgcacaggacggcttctccacgcagagcgttaccgtatccgtcgat
ggtgtacagcgggtcctggaagccggcgagcgacttgttcttgatcccggatcgagtctg
agccttccccagcgcctatatcatcgctttttcgccgtaaagggatacggaaaggtcatg
tgcggagaggtcagcatggtaaacgacgacgacagcgacaatcgtttcaaggaggaactt
ggacgctttcctgccattgaggaggatgtacctcctacgcggcttatggttggtgattac
cggagatttgcatga

DBGET integrated database retrieval system