KEGG   Sediminispirochaeta smaragdinae: Spirs_3064Help
Entry
Spirs_3064        CDS       T01287                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00010  Glycolysis / Gluconeogenesis
ssm00052  Galactose metabolism
ssm00500  Starch and sucrose metabolism
ssm00520  Amino sugar and nucleotide sugar metabolism
ssm00521  Streptomycin biosynthesis
ssm00524  Neomycin, kanamycin and gentamicin biosynthesis
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01130  Biosynthesis of antibiotics
ssm01200  Carbon metabolism
Module
ssm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_3064
   00052 Galactose metabolism
    Spirs_3064
   00500 Starch and sucrose metabolism
    Spirs_3064
   00520 Amino sugar and nucleotide sugar metabolism
    Spirs_3064
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spirs_3064
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Spirs_3064
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Spirs_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADK82165
UniProt: E1R4S7
Position
3284566..3285513
Genome map
AA seq 315 aa AA seqDB search
MALQNSTHKFFIGIDIGGTKTAVSLGDEAGNIRKKERFATADHYEEVIDQACSSVRAMLD
FASPHKVEAIGISCGGPLDPAAGIIQAPPNLPTWIDVPVVDLIARRFDLPVYLENDANAC
ALAEWYWGNGRGCRNLIFLTFGTGLGAGFILDGRLYSGTSGLAGEVGHLRLAEEGPLCYG
KAGSWEGFCSGSGMSRLYEMKFGRSLSAKEICDRAEAGDARALEVTDTTAEYLGRGLALL
VDLFNPERVIIGSIFSRSEGLFRKRMEAVMKAEALPRTFSDCKVLPAGLGEHLGDMAALG
VAIGKLRQKEGSYDR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctttacagaacagtactcacaagtttttcatcggtatcgatatcggcggcacaaaa
acggcggtttctctcggcgacgaggcggggaatattagaaaaaaggagcgctttgccacg
gccgatcactacgaagaggtgatcgatcaggcctgttcctctgtccgggccatgctggat
ttcgcctcgccgcacaaggtagaggccatagggatcagctgcggaggcccccttgatccg
gcagccggtattattcaggcaccgccgaaccttcccacctggatcgatgttccggtggtc
gacctcattgcacgacgtttcgatcttcctgtctatctggaaaacgatgcaaacgcctgt
gcccttgccgagtggtattggggtaatggaaggggatgccggaatctgatcttcctcacc
ttcgggacagggcttggagcggggttcattctcgacggacggctctattcgggaaccagc
ggccttgccggagaggtcggccatctgcggcttgccgaagagggtcctctttgttacgga
aaagcgggttcctgggaggggttctgcagcggcagcggcatgagccgtctctacgagatg
aaattcggccgcagtctcagcgctaaggagatctgcgacagggcggaagcaggagatgct
cgggccttggaggttaccgacaccaccgcagaataccttggccgggggcttgccctcctc
gtcgatcttttcaatccggagcgggtgatcatcggaagcatcttctcaagaagcgaaggc
ctgtttcgcaagcggatggaagcggtgatgaaagcggaagccctgccccgcaccttcagc
gactgcaaggtactgcctgccggacttggggaacatctcggagacatggcggccctcggt
gtcgccatcggaaaattacgccaaaaggaaggttcttatgatagatga

DBGET integrated database retrieval system