KEGG   Sediminispirochaeta smaragdinae: Spirs_3564Help
Entry
Spirs_3564        CDS       T01287                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00010  Glycolysis / Gluconeogenesis
ssm00030  Pentose phosphate pathway
ssm00051  Fructose and mannose metabolism
ssm00052  Galactose metabolism
ssm00680  Methane metabolism
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spirs_3564
   00030 Pentose phosphate pathway
    Spirs_3564
   00051 Fructose and mannose metabolism
    Spirs_3564
   00052 Galactose metabolism
    Spirs_3564
  Energy metabolism
   00680 Methane metabolism
    Spirs_3564
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spirs_3564
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Spirs_3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADK82652
UniProt: E1R7E7
Position
complement(3835666..3836847)
Genome map
AA seq 393 aa AA seqDB search
MKGNILIGQSGGPTSVINASLAGAVEGVLEAGARGKIFGMQFGIEGFLEDRLIDLGALSS
DERKLLALTPSSALGSCRYKLKDDDLPVILERLKKQDIRYLFLAGGNDTMDTIHRIEAFA
RKEGYELYGVGIPKTVDNDLFGTDHTPGYGSAARYTALSLLQSGQLARDMQRVDRFVIHQ
TVGREAGWLAASSIMAKQGEGDAPHLIYLPERPLSREQVLKDVQECIKAYGFCSIVCGEG
IIWRDGTPVSASAAKDGFSNIEFGAMGGTSAAISLHQLIHEETGYRGEFQITESLSMCAD
DRASATDRSEAFSCGLEAARLAASGGSGSMICMERLAGDYAVRYGTVPLSEVAVRAKPMP
DHYINESGNGVTDAFLDYLRPLVGDMPKYQRLW
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaatattcttatcggacaatcgggcggcccaacctcagtcatcaacgcttcc
cttgcgggagcggtggagggagtgcttgaggccggagcgaggggcaagatattcggcatg
caattcggtatcgagggctttctggaggatcgtctcatcgaccttggggctctgtcttcc
gatgaacggaaattgctggcgctcaccccctcttccgccctcggctcgtgccgttacaaa
ttaaaagacgatgacctgccggttattctcgagcgactgaaaaaacaggatatacgctat
ctttttcttgccggtgggaacgacaccatggacaccatccacagaatagaggcctttgcc
cgtaaagagggctatgaactctacggagtcggcatcccgaagaccgtggataatgatctt
tttggtacggatcacacccccggctacggctctgctgccagatacaccgccctttctctc
cttcagtcggggcagcttgccagggacatgcagcgggtcgatcgttttgtgatccaccag
accgtcggacgggaagcgggatggcttgccgcatcgtcgataatggcgaagcagggtgag
ggagatgctccccatcttatctatctgccggaacggcccttgtccagggagcaggttttg
aaagatgtacaagaatgcatcaaggcctacggattttgttcgatcgtctgcggagagggc
atcatctggcgtgacgggacccctgtttcggcctctgccgcgaaggacgggttttcaaat
atcgagtttggggccatgggcggtaccagcgccgctatctcgcttcatcagctgatccat
gaggagaccggctaccggggagagttccagatcaccgaaagcctttccatgtgtgccgat
gaccgggcaagtgccaccgatcgaagcgaggccttttcctgtgggcttgaggctgcaagg
cttgcggcctccggcggaagcggaagcatgatttgcatggagcgccttgccggggattat
gccgtccgatacggtactgtccccttatccgaggtcgctgtacgggcaaagcccatgccg
gatcactatatcaatgagtcgggaaacggggtcaccgatgcctttctcgactaccttcgc
ccccttgtgggcgatatgccgaagtatcagcgattgtggtag

DBGET integrated database retrieval system