KEGG   Sediminispirochaeta smaragdinae: Spirs_4285Help
Entry
Spirs_4285        CDS       T01287                                 

Definition
(GenBank) homocysteine S-methyltransferase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00270  Cysteine and methionine metabolism
ssm00670  One carbon pool by folate
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Spirs_4285
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Spirs_4285
Enzymes [BR:ssm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Spirs_4285
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     Spirs_4285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: ADK83358
UniProt: E1RA39
Position
4623432..4625279
Genome map
AA seq 615 aa AA seqDB search
MLKPYLERLADGVLLFDGAVGTMLYEKGVFLNQCFEHVTLTSPEKVSELHREMIAAGAQA
VTTNTFGANRLRLDGYGLSELTGKINREAVRLAREAAGKEVYVAGSVGPLGKRVGPVGKI
DSEEARSVFREQMEALAEAGIDLFVLETFRNIDELLLAAETAKATAPEIPVQAQYSFRPL
RSEQYNNDLTPVFARLQESEHVDVLGINCSTGPAHMLDVILASGGVVSKPISVMPNAGYP
RDYEGRQLYMASPDYFAEYALKFLDAGVHVIGGCCGTTPLHIQKMAQAILHLDSSRHKGL
SIEVSSKEIERLEPVALEKRSAFGAALAKGEWITTVELVPPMGIDLSKAIAKAKTLGDAG
ITCVNVPDGPRASSRISTLVTCMEIQRNSGVETIQHICCRDKNLIGIQSELLGAQTAGVH
NLLLLTGDPPKVGNFPDATGVFDTDSIGLLSLADSLNQGIDLAGNRLHGQTSFVAGAGAN
PAAQVLEREVERAWKKAEAGAEYFITQPVFDVELLSTFLDKIKGTGKPVIAGIWPLASYR
NALFLHYEVPGISIPADLQERMKKHDTKEGAMEEGILIAREIIAKIRGRVAGVQVSPPFG
RLEAALQVIKNQEDI
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaccatatcttgaacgacttgccgacggggttctcctttttgacggggccgtt
ggtaccatgctctacgaaaagggggtctttctcaaccaatgctttgagcatgtgaccctt
acctctccggaaaaggtgtcggagctccaccgggaaatgatagcggcgggggcacaggcc
gtcaccaccaataccttcggagcaaacagattacggcttgacggttatggtctttccgag
cttaccgggaaaatcaacagagaagcggtccgcctggcccgggaggctgcgggaaaagag
gtttacgttgctggttcggtagggcccctgggcaaacgggtcggaccggtaggcaaaatc
gacagcgaagaggctcgcagtgtctttcgcgaacagatggaggcccttgccgaggcgggg
atcgatctcttcgttctcgaaacctttcgaaatatcgacgagctgctcttggccgccgaa
acggcaaaggcgacggccccggaaatcccggtgcaggcgcaatacagctttcgcccgcta
cgaagtgagcagtacaataacgatctcacccctgtctttgcgcgactccaggaatcggaa
catgtcgatgtgctgggaatcaattgctcaactggtccggcgcacatgctcgatgtcatt
cttgcctcgggcggagttgtcagcaaaccgatctcggtcatgcccaatgcaggctatccc
agggactatgagggcagacaactctacatggcaagcccagactactttgccgagtacgcc
ttgaaattccttgatgcaggggtacatgtgatcggtggatgctgcgggacgacgcccttg
catatacagaagatggcacaggcaattctccatctcgattcaagccgccataagggtctt
agcatagaggtttcaagcaaagaaatcgaaaggctggaaccggtggcattggaaaagcgc
agtgctttcggtgccgcccttgcaaagggagaatggattaccacggtggaattggttccc
cccatgggtatcgacctttcaaaggccatcgcaaaggccaaaacgttaggggatgcaggt
atcacctgtgtcaatgtaccagacggcccccgtgccagcagtcgcatcagtaccctggtg
acctgtatggaaatacagcggaacagcggggtggaaacgatccagcatatctgttgccgg
gataagaatctcataggaatacagtccgaacttctcggtgcacagacggccggtgtacat
aatcttcttctccttaccggagatcctccaaaggtgggaaactttcccgacgccaccggc
gttttcgatacagactcgataggcctactcagccttgcagacagcctcaatcaggggatc
gaccttgcgggaaatcgcctgcatggtcaaacctctttcgtcgcaggagcaggggcaaat
cccgccgcccaggtcctggagagggaggttgaacgggcctggaaaaaggcagaagcagga
gcagagtattttattactcagcctgtcttcgatgtcgaactgctttcaacctttctggat
aagatcaagggaacgggaaagcctgttattgccggtatatggcctctggcaagttaccgg
aacgccctcttcctccattacgaggtacccggtatttccattcccgcagatcttcaggaa
cggatgaaaaaacatgatacaaaagaaggggcgatggaagaaggaattctcatcgccagg
gaaatcattgcgaagatacgaggccgtgtcgccggcgtacaggtaagtccccccttcggg
agactcgaagccgcgctacaggtcatcaaaaatcaggaggacatatga

DBGET integrated database retrieval system