KEGG   Sediminispirochaeta smaragdinae: Spirs_4286Help
Entry
Spirs_4286        CDS       T01287                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00030  Pentose phosphate pathway
ssm01100  Metabolic pathways
ssm01110  Biosynthesis of secondary metabolites
ssm01120  Microbial metabolism in diverse environments
ssm01130  Biosynthesis of antibiotics
ssm01200  Carbon metabolism
ssm01230  Biosynthesis of amino acids
Module
ssm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ssm_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spirs_4286
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Spirs_4286
Enzymes [BR:ssm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Spirs_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: ADK83359
UniProt: E1RA40
Position
4625276..4627267
Genome map
AA seq 663 aa AA seqDB search
MNLEALRAAATSVRSLSMDAIQTANSGHPGLPMGCAELGALLYGEIMKHYPKNPQWPNRD
RFVLSAGHGSMFLYSLLHLSGYDLPLEELKRFRQIGSKTPGHPEYGYTPGVETTTGPLGA
GLSEAVGMAAAETFLAANFNTADAKVVDHYTWVLAGDGCMMEGISSEASSLAGHLKLGKL
IVFYDSNKISIEGSTSLAFTEDVAERYRAYGWQVLSGDMYDMEKTAALVEEAKAETGKPS
LIILASIIGKGSPNKAGSSKVHGSPLGVDEVIATRKNLGIPENESFYIAPKAKTYFTEKL
EERKASFDAWNTLFDSWSKAHPELRKKWDRWFEGDRKAAAEAALAAAKMPKYKVGDSVAT
RKAGGAALQAAAAAMENLVGGSADLAPSNNTALPDYGDYSAEERAGRTFHFGVREHAMGA
LANGLSLHGGLRSFAATFLVFSDYMRPQVRLSAIMKEPVVYVFTHDSIFVGEDGPTHQPI
EHAAALRIIPNVHVFRPADAEETVRAWELALLRDDGPSALLLTRQNLPVVEKADGSWRDS
MATKGAYIVRESNGAPKLVVVATGSELSMALEAVDLTERTDIRVVSMPCKERFLALSDDE
KAKLLPKGAEVYATEAGVSDGWEAVTGCRDRVFGINRFGESGPGEAVAEDIGFTAKAFAE
MLK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgaagctttacgggcggccgccacatcggtaaggtcgctctcgatggatgcc
attcagacagccaactcgggacatcctggactacccatgggctgcgcggaactgggagca
ctgctctacggcgaaatcatgaaacactacccaaagaatcctcaatggccgaaccgtgac
cgatttgtcttatctgccgggcatggttcgatgtttctctactcgctccttcatctttca
ggatacgaccttcccttagaagagttgaagcgttttcgtcagataggatcaaagacccct
ggacaccccgagtacggctatacccccggagtcgagaccacaaccgggcctctcggcgcc
ggcctttccgaagcggtcgggatggcggcggcggagacctttctggctgccaattttaac
accgccgatgcaaaggtggttgatcactacacctgggtccttgccggagacggttgtatg
atggagggaattagctccgaggccagcagccttgccggacatttgaaacttggcaagctt
atcgtcttctacgattcgaataaaatcagtattgaaggttccacatctctcgcctttacc
gaagatgttgccgaacgctaccgtgcatatggctggcaggtgctttccggcgacatgtac
gatatggaaaaaaccgccgcccttgtagaagaggctaaggcggaaacgggaaagccttcc
ctgattattcttgcctccattattggcaagggcagtcccaacaaggcgggcagttccaaa
gtgcatggttcccctcttggtgtcgatgaggtcattgcaacccgaaaaaatctcggtatc
cctgagaacgaatccttttatatcgctccgaaggcaaaaacgtatttcacggagaaactg
gaagaacgaaaggcctccttcgacgcctggaatacgctctttgattcctggagcaaggct
catcccgagcttcggaaaaagtgggaccgttggttcgaaggcgatagaaaagctgctgcc
gaagcagcccttgccgcggcgaagatgcctaaatataaggttggcgattccgtcgctaca
cgaaaggcaggaggcgccgccctccaggccgctgcagccgccatggaaaatcttgtcggt
gggtccgccgatctcgccccaagcaataacaccgctcttcccgactacggtgattacagt
gccgaggagagggccggcagaacctttcacttcggcgtcagagagcatgccatgggtgcc
ttggcaaacggtctttcactccacgggggtctccgttcctttgccgcaacctttctggtt
ttctccgattacatgcggccccaggtccggctatcggcgatcatgaaggaaccggtcgtc
tatgtctttacacacgattcgatctttgtgggtgaagatggcccgacccatcagcctatc
gaacacgccgcggcgttgcgtatcattcccaacgttcatgtcttccgccctgcggatgcc
gaagagacggtgagggcctgggaacttgcgcttctgagagacgacggcccctcggccctg
ctgctcacccgtcaaaaccttccggttgtggaaaaagcggacggctcatggcgcgattca
atggctacaaaaggtgcttatatcgtacgggaaagcaacggtgctccgaaacttgtggtc
gtggctacaggctccgagctttccatggcccttgaagcggtcgatctaacagagcgcacg
gacatcagggtcgtctccatgccctgcaaggagcgattcctagctctttccgacgacgaa
aaggccaagctgctgccgaaaggagcggaggtctatgccaccgaagcgggagtcagcgac
ggctgggaagctgttaccggctgccgggatagggtcttcggtatcaatcgcttcggagaa
tcgggcccaggtgaagccgttgccgaggatatcggctttaccgcaaaggcctttgcggaa
atgctaaagtag

DBGET integrated database retrieval system