KEGG   Shigella sonnei Ss046: SSON_0254
Entry
SSON_0254         CDS       T00274                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ssn  Shigella sonnei Ss046
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ssn02044]
    SSON_0254
Secretion system [BR:ssn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SSON_0254
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAZ87038
ShiBASE_China: SSO0254
UniProt: Q3Z5C4
Position
complement(276885..277385)
AA seq 166 aa
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVN
KHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLL
ELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGLVSNK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcaaaaaatttgaaggcagcgtcgcgccccgcgagcgtattaatatatcgtatgtc
ccaaaaacagatggccagacggctgaagtggaacttccgcttaacatgctcgttgtcggc
gataccggaaatacgcaggaaacatccccactggatgaacgtcaggcagtttccgttaac
aagcacaatttcggtgcagtgatggctgaagcagccattggcctcaattttactgtcccc
gccacgctgaagggaagcacaacagacgatgaactgaatgtggcgctgaatatcaaatca
ctggatgatttttcaccagatagcgtggcccggcaggttccggaagtgaataaattgctg
gaactgcgtgaagcactgactgcactgaaggggccgatgggtaaccttccggcattccgt
acccagctccaggcattgctggaaaatgaagagtcccgcgagcagttgctcaaagaaatc
ggtctggtgagcaataaataa

DBGET integrated database retrieval system