KEGG   Shigella sonnei Ss046: SSON_0331Help
Entry
SSON_0331         CDS       T00274                                 

Gene name
mhpE
Definition
(GenBank) 4-hydroxy-2-ketovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00360  Phenylalanine metabolism
ssn00362  Benzoate degradation
ssn00621  Dioxin degradation
ssn00622  Xylene degradation
ssn01100  Metabolic pathways
ssn01120  Microbial metabolism in diverse environments
ssn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SSON_0331 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSON_0331 (mhpE)
   00622 Xylene degradation
    SSON_0331 (mhpE)
   00621 Dioxin degradation
    SSON_0331 (mhpE)
Enzymes [BR:ssn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     SSON_0331 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AAZ87108
ShiBASE_China: SSO0331
UniProt: Q3Z554
Position
358245..359258
Genome map
AA seq 337 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIEVAHGDGLQGSSFNYG
FGAHSDLEWIEAAADVVRHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSA
QHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDR
FRALKAVLKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDASFAGMGAGAGNAPLEVFI
AAADKLGWQHGTDLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCETAAA
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaaaaaactttatatctcggacgtcacattgcgtgacggtatgcacgccatt
cgtcatcagtattcgctggaaaacgttcgccagattgccaaagcactggacgatgcccgc
gtggattcgattgaagtggcccacggcgacggtttgcaaggttccagctttaactatggt
ttcggcgcacatagcgaccttgaatggattgaagcggcggcggatgtggtgaggcacgcc
aaaatcgcgacgttgttgctgccaggaatcggcactattcacgatctgaaaaatgcctgg
caggctggcgcgcgggtggttcgtgtggcaacgcactgtaccgaagctgatgtttccgcc
cagcatattcagtatgcccgcgagctcggaatggacaccgttggttttctgatgatgagc
catatgaccacgccggagaatctcgccaagcaggcaaagctgatggaaggctacggtgcg
acctgtatttatgtggtggattctggcggtgcgatgaacatgagcgatatccgtgaccgt
ttccgcgccctgaaagcagtgttgaaaccagaaacgcaaaccggcatgcacgctcaccat
aacctgagtcttggcgtggcgaactctatcgcggcggtggaagagggctgcgaccgaatc
gacgccagcttcgcgggaatgggcgcgggcgcaggtaacgcaccgctggaagtgtttatt
gccgccgcggataaactgggctggcagcatgggaccgatctctatgcgttaatggatgcc
gccgacgacctggtgcgtccgttgcaggatcgtccggtacgagtcgatcgcgaaacgctg
gcgctgggatacgctggtgtttactcgagcttcctgcgtcactgtgaaacggcggcggcg
cgttatggcttaagtgcggtggatattctcgttgagctgggcaaacgccggatggttggc
ggccaggaggatatgatcgtcgacgtggcgctggatctgcgcaacaacaaataa

DBGET integrated database retrieval system