KEGG   Shigella sonnei Ss046: SSON_0347Help
Entry
SSON_0347         CDS       T00274                                 

Gene name
hemB
Definition
(GenBank) 5-aminolevulinate dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00860  Porphyrin and chlorophyll metabolism
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01120  Microbial metabolism in diverse environments
Module
ssn_M00121  Heme biosynthesis, glutamate => heme
ssn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSON_0347 (hemB)
Enzymes [BR:ssn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SSON_0347 (hemB)
Exosome [BR:ssn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSON_0347 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: AAZ87123
ShiBASE_China: SSO0347
UniProt: Q3Z539
Position
complement(372834..373841)
Genome map
AA seq 335 aa AA seqDB search
MHLNSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccttaattccacaaacatcaggcagaccatgacagacttaatccaacgccctcgt
cgcctacgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgccaggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtatccgttccgtaatgacttttggcatctctcaccataccgatgaaaccggc
agcgacgcctggcgggaagatggactggtggcgcgtatgtcgcgcatctgcaagcagact
gtgccagaaatgatcgtcatgtcagacacttgtttctgtgaatacacttctcacggtcac
tgcggtgtgctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagccgtggttgcagctgctgcaggcgcagacttcatcgccccttccgccgcgatggac
ggccaggtacaggcgattcgtcaggcgctggacgctgcaggctttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcttccttttatggcccgttccgtgaagctgccgga
agcgcattaaaaggcgaccgcaaaagctatcagatgaacccaatgaaccgtcgcgaggcg
attcgtgaatcactgctggatgaagcccagggcgcagactgcctgatggttaaacctgct
ggagcgtacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtacgcgatgattaagttcgccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcaattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system