KEGG   Shigella sonnei Ss046: SSON_0461Help
Entry
SSON_0461         CDS       T00274                                 

Gene name
adk
Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00230  Purine metabolism
ssn00730  Thiamine metabolism
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01130  Biosynthesis of antibiotics
Module
ssn_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SSON_0461 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SSON_0461 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssn04147]
    SSON_0461 (adk)
Enzymes [BR:ssn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     SSON_0461 (adk)
Exosome [BR:ssn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSON_0461 (adk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 ADK_lid Hydin_ADK AAA_33 AAA_18 AAA_28 Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: AAZ87237
ShiBASE_China: SSO0461
UniProt: Q3Z4S5
Position
489363..490007
Genome map
AA seq 214 aa AA seqDB search
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVT
DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRI
VGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIG
YYFKEAEAGNTKYAKVDGTKSVAEVRADLEKILG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcattctgcttggcgctccgggcgcggggaaagggactcaggctcagttcatc
atggagaaatatggtattccgcaaatctccactggcgatatgctgcgtgctgcggtcaaa
tctggctccgagctgggtaaacaagcaaaagacattatggatgctggcaaactggtcacc
gacgaactggtgatcgcgctggttaaagagcgcattgctcaggaagactgccgtaatggt
ttcctgttggacggcttcccgcgtaccattccgcaggcagacgcgatgaaagaagcgggc
atcaatgttgattacgttctggaattcgacgtaccggacgaactgattgttgatcgtatc
gtaggccgccgcgttcatgcgccgtctggtcgtgtttatcacgttaaattcaatccgccg
aaagtagaaggcaaagacgacgttaccggtgaagaactgactacccgtaaagacgatcag
gaagaaaccgtgcgtaaacgtctggttgaataccatcagatgactgcaccgctgatcggc
tactacttcaaagaagcggaagcgggtaacaccaaatacgcgaaagttgacggcaccaag
tcggttgctgaagttcgcgctgatctggaaaaaatcctcggctaa

DBGET integrated database retrieval system