KEGG   Shigella sonnei Ss046: SSON_0814
Entry
SSON_0814         CDS       T00274                                 

Definition
(GenBank) putative transport system permease protein
  KO
K13891  glutathione transport system permease protein
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSON_0814
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssn02000]
    SSON_0814
Transporters [BR:ssn02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Glutathione transporter
    SSON_0814
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: AAZ87561
ShiBASE_China: SSO0814
UniProt: Q3Z3V1
Position
867143..868054
AA seq 303 aa
MRLFNWRRQAVLNAMPLVKPDQVRTPWHEFWRRFRRQHMAMTAALFVILLIVVAIFARWI
APYDAENYFDYDNLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAAIGT
LLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAVAIFSIPAFA
RLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASL
SFLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPK
IKG
NT seq 912 nt   +upstreamnt  +downstreamnt
atgcgactatttaactggcgacgtcaggcggtgttaaacgccatgccactggtcaaacct
gaccaggtgcgtacaccgtggcatgaattctggcgacgatttcgccgtcagcatatggcg
atgaccgccgcattattcgttattttattgattgtggtggccatttttgcacgctggatc
gctccctatgacgccgaaaattattttgattatgacaatctgaataacggaccttctttg
cagcactggtttggcgtcgattcactggggcgcgacattttcagccgtgtcctggttggt
gcgcaaatctcgctggcggcgggcgtgtttgccgtgtttatcggtgcggcgatcgggacg
ttgctgggcttgttggctggatattatgaaggctggtgggatcggctgatcatgcgcatt
tgcgatgtgctgtttgccttcccgggtattttactggcgatcgctgttgttgcggtgttg
ggaagcggcattgctaacgtgattatcgcagtcgccattttttccatccccgcgtttgcc
cgactggtgcgcggcaacacgctggtgttgaaacagcaaacctttattgagtcagcacgc
agtattggtgccagcgatatgaccattttattgcgtcatatcttgcctgggaccgtctcg
tctatcgtggtgtttttcaccatgcgcattggcacctcgattatctctgccgccagcctg
tcatttctcggcctcggtgcgcagccgccgacaccagagtggggagcaatgctcaatgag
gcacgagcggatatggttatcgcgccgcatgtcgctgtttttccggccctggctattttt
ctgaccgtactggcgttcaatttgttgggcgatggtttacgcgatgcgctggatccgaaa
attaaaggatag

DBGET integrated database retrieval system