KEGG   Shigella sonnei Ss046: SSON_0960
Entry
SSON_0960         CDS       T00274                                 

Gene name
ycbG
Definition
(GenBank) putative dehydrogenase
  KO
K09911  uncharacterized protein
Organism
ssn  Shigella sonnei Ss046
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SSON_0960 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: AAZ87697
ShiBASE_China: SSO0960
UniProt: Q3Z3G5
Position
1036578..1037030
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENEPVLVNGWIDK
HMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIVWQRLAGLAQRRGKTLSETIV
QLIEDAENKEKYANKMSSLKQDLQALLGKE
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaagtatctggtgaag
aagcatcgcgaaggggagttaatcacccgttacatagaagccagtgccgcccaggaagcc
gtcgatgtgttgctctcgctggaaaatgaacccgtgctggtaaatggctggattgacaag
catatgaatccggaactggtcaatcgcatgaagcaaaccattcgggcaagacgaaagcgc
cattttaatgcggaacaccagcatacgcgcaaaaaatcgatcgatctggaatttattgtc
tggcaacgtctggctggtcttgcgcagcgtcgcggtaaaacgctttctgaaacgattgtt
cagctgattgaagatgcggaaaacaaagagaaatacgcgaataaaatgtcttctctgaag
caggatctgcaggcattgctgggtaaggaataa

DBGET integrated database retrieval system