KEGG   Shigella sonnei Ss046: SSON_1382Help
Entry
SSON_1382         CDS       T00274                                 

Gene name
yeaD
Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00010  Glycolysis / Gluconeogenesis
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01120  Microbial metabolism in diverse environments
ssn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSON_1382 (yeaD)
Enzymes [BR:ssn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SSON_1382 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AAZ88093
ShiBASE_China: SSO1382
UniProt: Q3Z2B9
Position
complement(1456380..1457285)
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPA
GEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHNEDAD
GVALTFELTQSEETKKFCPHDFTLLAHFRVGKTCEIDLESHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSISMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaagtaaaagcctcttttgcattacagggcgcacaccttctctcgtggaaacctgcg
ggtgaagaagaagttctgtggttgagcaacaacacaccgttcaaaaatggcgtcgctatt
cgcggtggcgtaccggtttgctggccgtggtttggtccggcggcacaacaaggtctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacataatgaagatgctgat
ggcgtagcgctgacttttgaattgacgcaaagcgaagagacgaaaaaattctgtccgcac
gactttacgctgttagcgcatttccgcgtgggtaaaacctgtgaaatcgatcttgaatca
catggcgaatttgaaaccacctctgccctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtgggctgggcgatcgcttcattgataaagtgaatgacgcgaaagaa
gatgtactgaccgacggtattcagaccttccctgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtgattaatgatgaagcgctgaatcgtattatcgccgtaggccac
cagcatcatctgaacgttgtaggctggaacccgggaccggcgctttcaattagcatgggc
gatatgccggatgatggctacaaaacatttgtttgtgtagaaacggcttacgcttcagaa
acgcaaaaagtcaccaaagagaaacctgcacatctggcgcaatccattcgcgttgcgaaa
cgttaa

DBGET integrated database retrieval system