KEGG   Shigella sonnei Ss046: SSON_1603Help
Entry
SSON_1603         CDS       T00274                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00250  Alanine, aspartate and glutamate metabolism
ssn00650  Butanoate metabolism
ssn00760  Nicotinate and nicotinamide metabolism
ssn01100  Metabolic pathways
ssn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SSON_1603
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSON_1603
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SSON_1603
Enzymes [BR:ssn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SSON_1603
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     SSON_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AAZ88301
ShiBASE_China: SSO1603
UniProt: Q3Z1R1
Position
1683298..1684710
Genome map
AA seq 470 aa AA seqDB search
MTHKGDTPMTITPATHAISINPATGEQLSVLPWAGANDIENALELAAAGFRDWRETNIDY
RAEKMRDIGKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEP
TLVENQQAVIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLI
AQVFKDAGIPQGVYGWLNADNDGVSQMIKDSRIAAVTVTGSVRAGAAIGAQAGAALKKCV
LELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIASAFTERFVAAA
AALKMGDPRDEENTLGPMARFDLRDELHHQVEKTLAQGARLLLGGEKMAGAGNYYPPTVL
ANVTPEMTAFREEMFGPVAAITVAKDAEHALELANDSEFGLSATIFTTDETQARQMAARL
ECGGVFINGYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKDRI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaggagataccccgatgaccattactccggcaactcatgcaatttcaata
aatcctgccacgggtgaacaactttctgtgctgccgtgggctggcgctaacgatatcgaa
aacgcacttgagctggcggcagcaggctttcgcgactggcgcgagacaaatatagattat
cgtgctgaaaaaatgcgtgatatcggtaaggctctgcgcgcccgtagcgaagaaatggcg
caaatgatcacccgcgaaatgggcaaaccaatcaaccaggcgcgcgctgaagtggcgaaa
tcggcgaatttgtgtgactggtatgcagaacatggtccggcaatgctgaaggcggaacct
acactggtggaaaatcagcaggcggttattgagtatcgaccgttggggacgattctggcg
attatgccgtggaattttccgttatggcaggtgatgcgtggcgctgttcccatcattctt
gcaggtaacggctacttacttaaacatgcgccgaatgtgatgggatgtgctcagctcatt
gcccaggtgtttaaagatgcgggaatcccgcaaggcgtatatggctggctgaatgccgac
aacgacggtgtcagtcagatgattaaagactcgcgcattgctgctgtcacggtgaccgga
agtgttcgtgctggagcggctattggcgcacaggctggagcggcactgaaaaaatgcgta
ctggaactgggcggttcggatccgtttattgtgcttaacgatgccgatctggaactggcg
gttaaagcggcggtagccggacgttatcagaataccggacaggtatgtgcagcggcaaaa
cgctttattatcgaagagggaattgcttctgcatttaccgaacgttttgtggcagctgcg
gcagccttgaaaatgggcgatccccgtgacgaagagaacactctcggaccaatggctcgt
tttgatttacgtgatgagctgcatcatcaggtagagaaaaccctggcgcagggtgcgcgt
ttgttactgggcggggaaaagatggctggggcaggtaactactatccgccaacggttctg
gcgaatgttaccccagaaatgaccgcgtttcgggaagaaatgtttggccccgttgcggca
atcaccgttgcgaaagatgcagaacatgcgctggaactggctaatgatagtgagttcggc
ctttcagcgaccatttttaccaccgacgaaacacaggccagacagatggcggcacgtctg
gaatgcggtggggtgtttatcaatggttattgtgccagcgacgcgcgagtggcctttggt
ggcgtgaaaaagagtggctttggtcgtgagctttcccatttcggcttacacgaattctgt
aatatccagacggtgtggaaagaccggatctga

DBGET integrated database retrieval system