KEGG   Shigella sonnei Ss046: SSON_2283Help
Entry
SSON_2283         CDS       T00274                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00071  Fatty acid degradation
ssn00280  Valine, leucine and isoleucine degradation
ssn00310  Lysine degradation
ssn00362  Benzoate degradation
ssn00380  Tryptophan metabolism
ssn00620  Pyruvate metabolism
ssn00630  Glyoxylate and dicarboxylate metabolism
ssn00640  Propanoate metabolism
ssn00650  Butanoate metabolism
ssn00900  Terpenoid backbone biosynthesis
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01120  Microbial metabolism in diverse environments
ssn01130  Biosynthesis of antibiotics
ssn01200  Carbon metabolism
ssn01212  Fatty acid metabolism
ssn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSON_2283 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSON_2283 (atoB)
   00640 Propanoate metabolism
    SSON_2283 (atoB)
   00650 Butanoate metabolism
    SSON_2283 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    SSON_2283 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSON_2283 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSON_2283 (atoB)
   00310 Lysine degradation
    SSON_2283 (atoB)
   00380 Tryptophan metabolism
    SSON_2283 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSON_2283 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSON_2283 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SSON_2283 (atoB)
Enzymes [BR:ssn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSON_2283 (atoB)
Exosome [BR:ssn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSON_2283 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAZ88930
ShiBASE_China: SSO2283
UniProt: Q3YZY2
Position
2401082..2402266
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGSLASTSAIDLGATVIKAAIERAKIDSLHIDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQAGQAKSIVAGGMENMSL
APYLLDAKARSGYRLGDGQVYDVILRDGLMCATHGYHMGITAENVAKEYGITREMQDELA
LHSQRKAAAAIESGAFTAEIVPVNVVTRKKTFVFSQDEFPKANSTAEALGALRPAFDKAG
TVTAGNASGINDGAAALVIMEESAALAAGLTPLARIKSYASGGVPPALMGMGPVPATQKA
LQLAGLQLADIDLIEANEAFAAQFLAVGKTLGFDSEKVNVNGGAIALGHPIGASGARILV
TLLHAMQARDKTLGLATLCIGGGQGIAMVIERLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagtgcggtacgtactgctatcggtagttttaacggttca
ctcgcttccaccagcgccatcgacctgggggcgacagtaattaaagccgccattgaacgt
gcaaaaatcgattcactacacattgatgaagtgattatgggtaacgtgttgcaagccggg
ttggggcaaaatccggcacgtcaggcactgttaaaaagcgggctggcagaaacggtgtgc
ggattcacggtcaataaagtgtgtggttcgggtcttaaaagtgtggcgcttgccgcccag
gcaattcaggcaggtcaggcgaagagcattgtggcggggggtatggaaaatatgagttta
gcgccctacttactcgatgcaaaagcacgctctggttatcgtcttggagacggacaggtt
tatgacgtaatcctgcgcgatggcctgatgtgcgccacccatggttatcatatggggatt
accgccgaaaacgtggctaaagagtacggaattacccgtgaaatgcaggatgaactggcg
ctacattcacagcgtaaagcggcagccgcaattgagtccggtgcttttacagccgaaatc
gtcccggtaaatgttgtcactcggaagaaaaccttcgtcttcagtcaagacgaattcccg
aaagcgaattcaacggctgaagcgttaggtgcattgcgcccggccttcgataaagcagga
acagtcaccgctgggaacgcgtctggtattaacgacggtgctgccgctctggtgattatg
gaagaatctgcggcgctggcagcaggccttacccccctggctcgcattaaaagttatgcc
agcggtggcgtgcctcccgcattgatgggtatggggccagtacctgccacgcaaaaagcg
ttacaactggcggggctgcaactggcagacattgatctcatcgaagctaatgaagcattt
gctgcacagttcctcgccgttgggaaaaccctgggctttgattctgagaaagtgaatgtc
aacggcggggccatcgcgctcgggcatcctatcggtgccagtggtgctcgtattctggtc
acactattacatgccatgcaggcacgcgataaaacgctggggctggcaacactgtgcatt
ggtggcggccagggaattgcgatggtgattgaacggttgaattaa

DBGET integrated database retrieval system