KEGG   Shigella sonnei Ss046: SSON_3707Help
Entry
SSON_3707         CDS       T00274                                 

Gene name
zntA
Definition
(GenBank) zinc-transporting ATPase
  KO
K01534  Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 7.2.2.12]
Organism
ssn  Shigella sonnei Ss046
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SSON_3707 (zntA)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     SSON_3707 (zntA)
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.12  P-type Zn2+ transporter
     SSON_3707 (zntA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AAZ90253
ShiBASE_China: SSO3707
UniProt: Q3YW59
Structure
PDB: 

Position
3883720..3885918
Genome map
AA seq 732 aa AA seqDB search
MSTPDNHGKKAPQFAAFKPLTTVQNANDCCCDGACSSSPTLSENVSGTRYSWKVSGMDCA
ACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESAVQKAGYSLRDEQAADEP
QASRLKENLPLITLIVMMAISWGLEQFNHPFGQLAFIATTLVGLYPIARQALRLIKSGSY
FAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARQGVSALMALKPETAT
RLRNGEREEVAINSLRPGDVIEVAAGGRLPADGKLLSPFASFDESALTGESIPVERATGD
KVPAGATSVDRLVTLEVLSEPGASAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMA
VALLVTLVPPLLFAASWQEWIYKGLTLLLIGCPCALVISTPAAITSGLAAAARRGALIKG
GAALEQLGRVTQVAFDKTGTLTVGKPRVTAIHPATGISESELLTLAAAVEQGATHPLAQA
IVREAQVAELAIPTAESQRALVGSGIEAQVNGERVLICAAGKHPADAFAGLINELESAGQ
TVVLVVRNDDVLGIIALQDTLRADAATAISELNALGVKGVILTGDNPRAAAAIAGELGLE
FKAGLLPEDKVKAVTKLNQHAPLAMVGDGINDAPAMKAAAIGIAMGSGTDVALETADAAL
THNHLRGLVQMIELARATHANIRQNITIALGLKGIFLVTTLLGMTGLWLAVLADTGATVL
VTANALRLLRRR
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacctgacaatcacggcaagaaagcccctcaatttgctgcgttcaaaccgcta
accacggtacagaacgccaacgactgttgctgcgacggcgcatgctccagctcgccaacg
ctctctgaaaacgtctccggcacccgctatagctggaaagtcagtggcatggactgcgcc
gcctgtgcgcgcaaggtagaaaatgccgtgcgccagcttgcaggtgtgaatcaggtgcag
gtgttgttcgccaccgaaaaactggtggttgatgccgacaatgacattcgtgcacaagtt
gaatctgcggtgcaaaaagcgggctattccctgcgcgatgagcaggccgccgacgagcca
caagcatcgcgcctgaaagagaatctgccgctgattacactaatcgtgatgatggcaatc
agctggggtctggagcagttcaatcatccgttcgggcaactggcgtttatcgcgaccacg
ctggttgggctgtacccgattgctcgtcaggcattacggctgatcaaatccggcagctac
ttcgccattgaaaccttaatgagcgtagccgctattggtgcactgtttattggcgcaacg
gctgaagctgcgatggtgttgctgctgtttttgattggtgaacgactggaaggctgggcc
gccagccgcgcgcgtcagggcgttagcgcgttaatggcgctgaaaccagaaaccgccacg
cgcctgcgtaacggtgagcgggaagaggtggcgattaacagcctgcggcctggcgatgtg
attgaagtcgccgcaggtgggcgtttgcctgccgacggtaaactgctctcaccgtttgcc
agttttgatgaaagcgccctgaccggagaatccattccggtggagcgcgcgacgggcgat
aaagttcctgcaggagccaccagcgtagaccgtctggtaacgctggaagtgctgtcagaa
ccgggtgccagcgccattgaccggattctgaaactgatcgaagaagccgaagagcgtcgc
gcccccattgagcggtttatcgaccgtttcagccgtatctatacgcccgcgattatggcc
gtcgctctgctggtgacgctggtgccaccgctgctgtttgccgccagctggcaggagtgg
atttataaagggctgacgctgctgctgattggctgcccgtgtgcgttagttatctcaacg
cctgcggcgattacctccgggctggcggcggcagcgcgtcgtggggcgttgattaaaggc
ggagcggcgctggaacaactaggtcgtgttactcaggtggcgtttgataaaaccggtacg
ctgaccgtcggtaaaccgcgcgttaccgcgattcatccggcaacgggtattagtgaatct
gaactgctgacactggcggcggcggtcgagcaaggcgcgacgcatccactggcgcaagcc
atcgtacgcgaagcacaggttgctgaactcgccattcccaccgccgaatcacagcgggcg
ctggtcgggtctggcattgaagcgcaggttaacggtgagcgcgtattgatttgcgctgcc
gggaaacatcccgctgatgcatttgctggtttgattaatgaactggaaagcgccgggcaa
acggttgtgctggtagtacgtaatgatgacgtgctgggtatcattgcattgcaggatacc
ctgcgcgccgatgctgcaactgccatcagtgaactgaacgcgctgggggtcaaaggagtg
atcctcaccggcgataatccacgtgcagcggcggcaatcgccggggagctggggctggag
tttaaagcgggcctattgccggaagataaagtcaaagcggtgaccaagctgaatcaacat
gcgcccctggcgatggtcggtgatggtattaacgacgcgccagcgatgaaagctgccgcc
attgggattgcaatgggcagtggcacagacgtggcgctggaaaccgctgatgcagcatta
acccataaccacctgcgcggcctggtgcaaatgattgaactggcacgcgccactcacgcc
aatatccgccagaacatcaccattgcgctggggctgaaagggatcttcctcgtcaccacg
ctgttagggatgaccggcctgtggctggcggtgctggcagatacgggtgcgacggtgctg
gtgacagcgaatgcgttaagattgttgcgcaggagataa

DBGET integrated database retrieval system