KEGG   Shigella sonnei Ss046: SSON_4085Help
Entry
SSON_4085         CDS       T00274                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn00010  Glycolysis / Gluconeogenesis
ssn00030  Pentose phosphate pathway
ssn00051  Fructose and mannose metabolism
ssn00052  Galactose metabolism
ssn00680  Methane metabolism
ssn01100  Metabolic pathways
ssn01110  Biosynthesis of secondary metabolites
ssn01120  Microbial metabolism in diverse environments
ssn01130  Biosynthesis of antibiotics
ssn01200  Carbon metabolism
ssn01230  Biosynthesis of amino acids
ssn03018  RNA degradation
Module
ssn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSON_4085 (pfkA)
   00030 Pentose phosphate pathway
    SSON_4085 (pfkA)
   00051 Fructose and mannose metabolism
    SSON_4085 (pfkA)
   00052 Galactose metabolism
    SSON_4085 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SSON_4085 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSON_4085 (pfkA)
Enzymes [BR:ssn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSON_4085 (pfkA)
Protein phosphatases and associated proteins [BR:ssn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSON_4085 (pfkA)
Messenger RNA biogenesis [BR:ssn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SSON_4085 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AAZ90600
ShiBASE_China: SSO4085
UniProt: Q3YV62
Position
4321593..4322555
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggcatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtttctgac
atgatcaaccgtggcggtacgttcctcggttctgcgcgcttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtggtatcgacgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggtctgccgggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgacgttggct
gcggccattgccggtggctgtgaattcgttgtggttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggttac
ggcggtcgttgtgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system