KEGG   Shigella sonnei Ss046: SSON_P190
Entry
SSON_P190         CDS       T00274                                 

Gene name
traD
Definition
(GenBank) TraD protein
Organism
ssn  Shigella sonnei Ss046
SSDB
Motif
Pfam: TrwB_AAD_bind TraD_N TraG-D_C T4SS-DNA_transf Amelogenin AAA_16 TFIIA Zeta_toxin AAA_10 AAA_22 DUF2076
Other DBs
NCBI-ProteinID: AAZ91210
ShiBASE_China: SSOP190
UniProt: Q3YTF2
Position
pSS_046:166425..168626
AA seq 733 aa
MFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMRDLIKSQPVYE
IQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGRDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSE
VIRRLANYARQRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDF
DNTANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTYL
RNSPAANLVEEKIEKTAISIRAVLTNYVKAIRYLQGIEHNGEPFTIRDWMRGVREDQKNG
WLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEIL
PEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIAEFAVGEIGEK
EHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQERPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAE
QPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPVSPVINDKKSDSGVNVPAG
GIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDTWQQMQRREEVNINVH
RERGEDVEPGDDF
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgttcagccagatcgccaatattatgctttactgcctgtttatttttttctggatactc
gttggtctggttttatgggtaaaaataagctggcagacgtttgtgaatggctgtatttac
tggtggtgtaccacgctggaaggcatgcgggatttaatcaagtctcagccggtatatgag
attcagtattacggcaaaaccttccggatgaacgctgctcaggtactgcatgataaatat
atgatctggtgcggtgagcagttatggtctgcattcgttctggccacagttgtggcactg
gttatttgcctgattaccttctttgttgtctcctggattctggggcgtcagggtaaacaa
cagagcgaaaatgaagtcacaggtggtcgtcaactgacagacaatccgaaagacgttgcc
cggatgctgaaaaaagacggcagggactccgatatccggattggcgatctgccgattatc
cgggattccgaaatccagaacttctgtctgcacggcacggtcggggccggtaagtcggag
gttatccgtcgtctggccaactacgcccgtcagcgtggtgatatggtggtgatttatgac
cgttcaggggaatttgttaaaagttactatgatccctccatcgataagatcctgaatccg
ctggatgcacgctgtgccgcctgggatttgtggaaggagtgcctgacacagccggatttt
gataataccgcaaatactctgatcccgatgggcacaaaagaggacccgttctggcagggt
tcaggacgtaccatttttgcggaagcggcgtatctgatgcgtaatgaccccaaccgcagc
tacagcaaactggtggacacactgctttccatcaaaattgaaaaactgcgtacctacctg
cgtaattcaccggcggccaacctggtggaagagaaaattgagaaaacggcgatttccatc
cgtgctgtgctgaccaactatgtgaaagccatccgttacctgcaggggattgagcataac
ggtgagcccttcaccatccgtgactggatgcgtggtgtccgggaggatcagaaaaacggc
tggctgtttatctcgtcgaatgccgacactcatgcctccctgaagccggtgatctccatg
tggctgtccattgccattcgtggtctgctggcaatgggagaaaaccgtaatcgtcgtgtg
tggttcttctgtgatgagttacccacattacacaaactgccggacctggtggagatcctg
ccggaagcccgtaagttcggtggctgttatgtgtttggtatccagtcctatgcccagctg
gaagatatctacggtgagaaagcggctgccacgctgtttgacgtcatgaacacccgtgcc
tttttccgttctcccagccataagattgcggagttcgctgtcggtgaaattggtgagaaa
gagcacctgaaagccagcgaacagtattcctacggtgctgatccggtacgtgacggggta
tcgaccggtaaggatatggagcgccagacgctggtcagttattccgacattcagtccctg
ccggatctgacctgctatgtcaccctgcccggaccgtatccggcagtcaaactctcactg
aaatatcaggaacgtccgaaggtcgctccggagtttattccgcgtgacatcaacccggaa
atggagaaccgtctgagtgccgtacttgccgcaagggaagcagaaggtcgtcagatggcc
agcctcttcgaaccggatgtcccggaggttgtttccggagaagacgtgactcaggctgaa
cagccgcaacagccgcaacagccgcaacagccgcaacagccgcaacagccgcaacagccg
caacagccgcaacagccgcaacagccgcaacagccgcaacagccgcaacagccgcaacag
ccggtgtctcctgtcatcaacgataagaagtcagattcaggtgtgaatgttccggcaggg
gggattgagcaggagctgaaaatgaaaccggaagaagagatggaacagcaactgccaccc
gggatcagtgaatccggtgaagtggtggatatggccgcttatgaggcatggcagcaggaa
aatcatccggacacctggcagcagatgcagcgtcgtgaagaggtgaacatcaatgtgcac
cgggaacgcggggaggatgttgagccgggagatgatttctga

DBGET integrated database retrieval system