KEGG   Sulfolobus solfataricus P2: SSO1368Help
Entry
SSO1368           CDS       T00054                                 

Definition
(GenBank) Second ORF in transposon ISC1316
  KO
K07496  putative transposase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OrfB_Zn_ribbon OrfB_IS605 zf-ribbon_3 DUF1610 Synapsin_N
Motif
Other DBs
NCBI-ProteinID: AAK41602
UniProt: Q97YF7
Position
1202740..1203462
Genome map
AA seq 240 aa AA seqDB search
MVKHHWRVVVKLTRSERIYITFVVDHEFPKLPNTGKVVAIDVGVEKLLVTSDGEYFPNLR
PYEKALWKVKHLHRELSRKKFLSHNWFKAKVKLARAYEHLKNLRTDLYMKLGKWFAEHYD
VVVMEDIHAKQLVGKSLRSLRRRLSDVGFGELRDVLKYQLEKYGKKLILVNPAYTSKTCA
RCGYVKNDLSLSDRVFVCPNCGWIADRDYNASLNILRGSGSERPLVWSSALYQYSGKVGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttggtgaaacaccactggagagtggtagtgaagctaacaagatctgagaggatatacatc
actttcgtagttgatcacgaattccccaagttacctaacactggtaaggtagtggcgata
gatgttggtgtagaaaagttgttagtaacgtcagatggtgagtattttcctaatttgaga
ccttacgagaaagcgttatggaaagtgaagcatctacacagagaactttcaaggaagaag
ttcctctctcataactggtttaaggctaaggttaagcttgctagggcttatgagcatttg
aagaatctaagaacggatctttacatgaagttgggtaagtggtttgctgagcattatgac
gttgtagtcatggaggacattcacgctaaacaacttgtgggtaagtccttgaggtctctg
agaaggaggctgagtgatgtgggatttggtgagttgagggatgtgctgaagtatcagctg
gaaaaatacggaaagaaactcatcctagttaatcctgcatacacttccaaaacttgtgct
aggtgcgggtatgtgaaaaatgacttgtctctatctgatcgtgttttcgtttgtcccaac
tgtggttggattgcagatcgtgactataatgcttctcttaacatcttacgtggatcgggg
tcggagcgacccttagtgtggagctccgccctctaccagtactctggcaaggtggggctg
tga

DBGET integrated database retrieval system