KEGG   Sulfolobus solfataricus P2: SSO1475Help
Entry
SSO1475           CDS       T00054                                 

Definition
(GenBank) Transposase ISC1476
  KO
K07496  putative transposase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OrfB_IS605 OrfB_Zn_ribbon RuvX
Motif
Other DBs
NCBI-ProteinID: AAK41702
UniProt: Q97Y67
Position
1335113..1336363
Genome map
AA seq 416 aa AA seqDB search
MKRSNTVRLVVSKEQHEVLKRLGIATAKCWNEVNWLRMKQYKEGKRVDFGITEKAVYEKY
KSVLRVNAQQVARKNAEDWRSFFSLTREKKEGKLPSWFKPRPPGYWKDGRLIVIIRNDRY
TVDERNRVVYLKDFNLSLKFKGRLKWHGKQGRLEIIYDEARKIWYAHIPVEVETEKVKEG
IKASIDLGIVNLATVYVEDGSWYLFKGGSALSHYENYSKRITIVQKTLHRHRQRRSRRLK
LLHEKRSRFLKHALNSMVRRIMEILREKNVGEVVVGYPKEIAKHHGNKLTVNFWNYSYII
KRLEDIGEELGIKVITVDEAYTSKTCSLCGEAHEDGRVKRGLFVCPRTRKAINADLNGAI
NILHIPESRGSEGNFHRGIGVIGLKTQPVTLSDLSKIKNHYNYSISDYTILHYIQP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggagtaacactgttaggctagtagtatctaaagagcaacatgaagtgttaaag
aggcttggtatagctacggctaagtgttggaatgaggttaattggttaaggatgaaacag
tacaaggaaggaaagagagtagattttggaattacagagaaggcagtgtatgaaaagtat
aagagtgtgctgagggttaatgcgcaacaagtagctaggaagaacgccgaagattggagg
agcttcttctcattaacccgtgagaagaaagagggaaaactacccagttggtttaaaccg
agaccaccgggttattggaaagatggaagattaatcgtaattatcagaaatgataggtac
actgtggatgaaaggaatagggtggtttatcttaaggattttaatctctcattgaagttt
aagggtaggttaaagtggcatgggaaacagggtaggctggaaataatttacgacgaggcg
agaaagatctggtacgcacatataccagttgaagttgaaactgagaaagttaaggaagga
ataaaggcatctattgatttaggtattgtgaacctagccacggtttatgttgaggacggc
tcgtggtacttattcaaaggtggatctgctttatctcattacgagaactacagtaagaga
attactatagttcagaagactttgcatagacataggcagaggaggagtagaaggcttaag
ttgcttcacgagaagaggagtaggttcctcaaacacgccttgaacagtatggtgaggagg
ataatggaaatactgagggagaaaaacgttggtgaggtggttgtaggttatcctaaagaa
atagctaaacatcatgggaataagctgactgttaacttctggaattattcgtatataata
aagaggcttgaggatattggtgaggagttggggataaaagtaataacagtggacgaggca
tatacttctaaaacgtgttccttgtgtggggaagcccatgaggatggacgtgtgaaaagg
ggattatttgtgtgtccccgcacaaggaaggcaataaatgcggacttaaacggagcaata
aatattctacatatccccgagtcccgaggaagcgagggcaacttccacagagggataggg
gtaattgggctgaagacccagcccgtgacgttgtccgatttgagcaaaattaaaaaccat
tataattacagcatttctgattatactattcttcattatattcagccataa

DBGET integrated database retrieval system