KEGG   Sulfolobus solfataricus P2: SSO3003Help
Entry
SSO3003           CDS       T00054                                 

Gene name
dhg-1
Definition
(GenBank) Glucose 1-dehydrogenase (dhg-1)
  KO
K18125  aldose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.359]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00030  Pentose phosphate pathway
sso00052  Galactose metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSO3003 (dhg-1)
   00052 Galactose metabolism
    SSO3003 (dhg-1)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.359  aldose 1-dehydrogenase [NAD(P)+]
     SSO3003 (dhg-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N Shikimate_DH FAD_binding_3 2-Hacid_dh_C Pyr_redox_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: AAK43106
UniProt: Q7LYI9
Structure
PDB: 

Position
complement(2743532..2744632)
Genome map
AA seq 366 aa AA seqDB search
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSTLPKGKD
FLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKM
DGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLN
CRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKL
KDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNK
TIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIK
IRILWE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctataatagtgaaacccccaaacgcgggagtgcaggtaaaggatgttgatgaa
aagaaattggacagctacgggaaaataaagataagaacaatctacaacggtatttgtggt
actgatagagagatagttaatggtaagttaacattgtcgactttacctaagggaaaggat
ttcttggtattgggtcatgaggcaataggtgttgtggaagagtcttatcatggtttttct
caaggagatctggtaatgccagttaataggagaggatgcggtatttgtagaaattgttta
gttgggagaccagacttttgtgaaacaggggaattcggagaagctggaatacacaaaatg
gatgggtttatgagggaatggtggtacgacgaccctaagtatttggttaaaattcctaag
tcaattgaagatattggaattttagcacaaccgttagcagacattgagaagtccattgag
gaaatattggaagttcagaaaagggttccagtgtggacttgtgatgatggaactctaaat
tgtaggaaagttctcgttgttggcaccggaccaattggagtcttatttactttgcttttt
agaacttatggactagaggtttggatggcaaacagaagagaacccactgaggtagaacag
accgttatagaggaaaccaaaactaactattataattcatccaatgggtacgacaaattg
aaagactcagtaggtaagttcgatgtaataatagacgcaacgggagcagatgtaaatata
ttaggtaatgttattccattgttaggaaggaacggagttttaggtctctttggattttca
acttctggttcagttccattggactacaagacattacaagaaatagtacacacaaataag
acgataataggtctagtgaatggtcaaaagccccacttccagcaagccgtagttcattta
gcctcttggaagactttatatcctaaggctgctaagatgctaattactaagactgtcagt
ataaatgatgaaaaagagttacttaaagtgcttagggaaaaggaacatggagaaatcaag
ataagaatattatgggaataa

DBGET integrated database retrieval system