KEGG   Saccharolobus solfataricus P2: SSO0071Help
Entry
SSO0071           CDS       T00054                                 

Gene name
rpoD
Definition
(GenBank) DNA-directed RNA polymerase, subunit D (rpoD)
  KO
K03047  DNA-directed RNA polymerase subunit D [EC:2.7.7.6]
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso03020  RNA polymerase
Module
sso_M00184  RNA polymerase, archaea
Brite
KEGG Orthology (KO) [BR:sso00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    SSO0071 (rpoD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sso03021]
    SSO0071 (rpoD)
Enzymes [BR:sso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     SSO0071 (rpoD)
Transcription machinery [BR:sso03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     SSO0071 (rpoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_A_bac RNA_pol_L Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AAK40433
UniProt: P95989
Structure
PDB: 

Position
complement(57588..58385)
Genome map
AA seq 265 aa AA seqDB search
MSINLLHKDDTRIDLVFEGYPLEFVNAIRRASMLYVPIMAVDDVYFIENNSPLYDEILAH
RLALIPFMSEEALDTYRWPEECIECTENCEKCYTKIYIEAEAPNEPRMIYSKDIKSEDPS
VVPISGDIPIVLLGTNQKISLEARLRLGYGKEHAKFIPVSLSVVRYYPKVEILANCEKAV
NVCPEGVFELKDGKLSVKNELSCTLCEECLRYCNGSIRISFVEDKYILEIESVGSLKPER
ILLEAGKSIIRKIEELEKKLVEVVK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcaacctacttcataaggacgatacgagaatagatctagtttttgagggttat
cctttagaatttgtgaatgcaattaggagagcatcgatgctttatgtgccaattatggct
gtcgacgacgtatattttattgagaataatagtcctttatatgatgagattttagcacat
aggttggctttaataccctttatgtcagaggaagctttagatacatatagatggccagaa
gaatgtatcgaatgtactgaaaattgtgaaaaatgctatactaaaatttacatcgaagcg
gaggcgccgaacgaacctaggatgatatactctaaagatataaagtcggaagacccatca
gtggttccaatatctggggatataccgattgtgttattaggtacaaatcaaaagatatcg
cttgaggctaggttaagattaggatacggaaaagaacacgctaagtttataccagtttct
ttatcagtagttagatattatccgaaagttgagatattagcaaactgtgagaaagcagtt
aatgtttgtccagagggtgtatttgaattaaaggatggtaagctctcagtaaagaatgaa
ctctcctgcaccttatgtgaagagtgtttgagatactgtaatggttcaattagaatttcc
ttcgtagaagataaatatattcttgagatcgagagtgttggatcgcttaagccagagaga
attttattagaggctggtaaaagcattataagaaagattgaagaattagagaagaaactg
gtagaggtggttaaatga

DBGET integrated database retrieval system