KEGG   Saccharolobus solfataricus P2: SSO0535Help
Entry
SSO0535           CDS       T00054                                 

Definition
(GenBank) Acyl carrier protein synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso00072  Synthesis and degradation of ketone bodies
sso00280  Valine, leucine and isoleucine degradation
sso00650  Butanoate metabolism
sso00900  Terpenoid backbone biosynthesis
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01130  Biosynthesis of antibiotics
Module
sso_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SSO0535
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SSO0535
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSO0535
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSO0535
Enzymes [BR:sso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SSO0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III HMG_CoA_synt_C Thiolase_C Chal_sti_synt_N
Motif
Other DBs
NCBI-ProteinID: AAK40854
UniProt: Q9UWU0
Position
complement(463667..464719)
Genome map
AA seq 350 aa AA seqDB search
MLSGILGWGAYIPRYRIKVEDIAKMWGYDEAVVKSLGLTEKSVPGHDEDSTTIAWESSIN
AIKRAQVDTSKIRLVLFGSESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLR
LASSFVLHNNDSYALVIGADTAQSNPGDVLELSSAAAGVAFVVGKTDEKHSAAVIEYSSS
YTSDTPDFWRRDGTPYPVHGEGFTGEPAYFHHIISAVNDLLQNSGLKISDFDYFVFHQPN
GKFPIQVAKKLGVPLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSG
AGSDAFSILVSEGILAKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKVYE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctctctggtattcttggatggggtgcttatattccaagatatagaataaaagtagag
gatatagctaagatgtggggttatgatgaggcagttgtgaaaagcctcggactgaccgag
aagtctgttcctggtcacgatgaggattctacaactatagcttgggaatcatcgataaat
gcaattaagagagctcaagttgatacttctaagataaggctagtcctttttggttcagaa
tctaaagtttacgctgtaaaacccacttctaccattttaatagacgcactaggcattaac
aattattcagcaactgcggatatggaatttgcatgtagggctgcatcggtaggattaagg
ttagcatcaagtttcgttttacataataacgatagttacgcgttagtaataggtgcagat
actgcacaatctaatccgggggatgttttagaactaagttcggcagcggctggtgttgct
tttgttgttggcaaaactgatgagaaacactcggctgccgtgatagaatattcttcatct
tatacctctgatactccagacttttggcgaagggatggaactccttatccagtccatggt
gagggttttactggagaaccagcttatttccatcatataatttccgctgttaacgatcta
ctacagaatagtggtttaaagatttctgatttcgactattttgtatttcaccagcccaat
ggtaagttcccgatccaagttgctaaaaagctgggtgtcccattagagaaagttaaacaa
gggttagtttctccatatattggtaatccctataatgcttctgccctattaggtttagct
aaagttttggacattgcgaaacctggtgaaaggatcttggttgctccatttggtagtggt
gctggtagtgacgcttttagtattttagtttctgaaggcatattggcgaagcaaaaattg
gctaaaaccgtagaatattatataaataataaaaaactcgtatcttatgctgaatatgct
aaatatactaataagataaaggtgtatgagtaa

DBGET integrated database retrieval system