KEGG   Saccharolobus solfataricus P2: SSO0999
Entry
SSO0999           CDS       T00054                                 

Definition
(GenBank) ABC Transporter
  KO
K17311  trehalose transport system substrate-binding protein
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSO0999
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sso02000]
    SSO0999
Transporters [BR:sso02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Trehalose transporter
    SSO0999
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8 FtsX VSP
Other DBs
NCBI-ProteinID: AAK41270
UniProt: Q97ZC3
Position
856747..858180
AA seq 477 aa
MSRSDKFSNKEKMRRGLSTTTIIGIVVAIVIIVIGAVAAVTLLSHKPSQVVSTTSPSTSQ
SATSTSPSQVITITYFDDLSPSEANITQKIIIPQFEATHPNIKINYVDESADDIVKSVVE
LVKSGNVGPVIIGEDNLVIGELLNGNYLMNLTPYVNQILQNVSLIPSMQSLVQYEQKVYH
GTYFIPLRANIPLVWYNASLFRQLGLASPPENWSQLLQYAKIIYDKTGVKPIMFQGHGGA
STYTELYQWMVQAGGNPFLFNDSGDVLAFEYLYNLSQYFNLEYIHGYWGSYKGLIDGSYY
LIDYQWPYIYSVMASEGVNMSNIGFYPGPTGPVNGDHLVGGDVLAIPKGATHIDALIEFA
KFLLSPQVQREFIIYLSWPAVNQQAYQNLPSNISSLYKAEEEALQNAFFREPVPWITVWG
QIADNVFNQIIVNHAPYSQIPQILSQANKEMYQYLLQNYNVTVAQEYEEGVFGPLYG
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtctcgctcagataaattctccaataaagagaaaatgagacgtggtttatccacaacc
acaataataggaatagtagtggcaatagtaataatcgtaataggagccgttgctgcggta
actctacttagtcataagccgtcacaagtagtatctaccacttctccgtctacttcgcaa
tcagcaacgtcaacatctccatcacaagttattaccataacctattttgacgatctatcg
ccatctgaagccaacataacacagaaaataataattccacaattcgaggcaacacatcct
aatattaaaattaattatgttgatgaaagtgctgacgatatagtaaaaagtgttgtagag
ttagtaaagagtggtaacgttggcccagttatcattggtgaagataatcttgttatagga
gaattgctcaatggtaactatttaatgaacctaactccatatgtaaatcaaatcttacag
aatgttagtctaattccatcgatgcaatcattagtccagtatgaacaaaaagtatatcat
ggtacttacttcattcctcttagagccaacattcctctagtctggtataacgcaagtctc
tttaggcaattaggtttggcttctccaccagaaaactggtcacaattgctacagtacgca
aagataatttatgataaaactggcgtaaaacccataatgttccaaggtcatggtggagca
agtacttatactgagctttaccagtggatggtccaggctggtggaaatccattcttattt
aatgattctggcgatgtacttgcatttgaatatttgtacaatctctcacaatattttaac
ctagagtatattcatggatattggggaagctataaaggattaattgatggtagttactat
ttgatcgattatcaatggccctatatctatagtgttatggccagtgaaggtgttaatatg
agcaatataggattctaccctggccctaccggccctgttaacggtgatcacttagtaggt
ggtgatgtattagcaatacctaagggagcaacacacattgatgcgctaatagaattcgct
aagttcttactatctccgcaagttcaaagagaatttatcatttacctctcatggccagca
gtaaatcaacaagcttatcagaatctcccaagtaatataagttcactatacaaagctgaa
gaagaagctttacagaacgcattcttcagagaaccagtaccttggataactgtttgggga
cagatagcagataacgtgtttaatcaaataatcgtaaatcatgcaccatattcacaaata
cctcaaatattaagtcaagcaaataaggaaatgtaccagtatctcttacaaaactataat
gtaacggtagcacaagagtatgaggaaggagtgtttggaccactatacgggtga

DBGET integrated database retrieval system