KEGG   Saccharolobus solfataricus P2: SSO1001
Entry
SSO1001           CDS       T00054                                 

Name
(GenBank) Sugar ABC transporter
  KO
K17313  trehalose transport system permease protein
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSO1001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sso02000]
    SSO1001
Transporters [BR:sso02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Trehalose transporter
    SSO1001
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AAK41272
UniProt: Q97ZC1
Position
859006..859809
AA seq 267 aa
MRLWVYLGAIVVGIYFLFPLYILVLLAFNSPKYTVLAKFPSLLPVSLTLNNLLTALQGTA
FIDPFIKSLETATLVGIITIALAIPAGYGLSRLPRAIAYSIIILLLVTNMMPAIVIGIPI
AVDFLKLHLFESVVGLALAQTLITLPLATFILQGTFSSIPIDLEHQARVDGANLFNRLFS
VLLPLAAPGIAAAFLISWMFSWDEFTYAILLIPYHSTLPVTIYQDVTRGNLLAGIAFSLI
FTLPVIILTFALQKYLRGEYLAGGIKG
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaggttgtgggtatatttaggtgcaatagtagtaggaatttactttctatttccactt
tacattttagtattactagcatttaattccccaaaatataccgtcttagcgaaattcccc
tcactattaccggtgtcactaacactaaataatctactaacagcattacaaggcacggca
tttattgatccattcataaaaagtctggagacagcaacattagtggggatcattaccata
gcattggctattccagcgggatatggtttaagtagattaccaagagccatagcatattcc
ataattatccttctattagttactaatatgatgccagcaatagtaataggtattccaata
gcagtagattttcttaaacttcatctttttgaatccgtagtaggtctagccttagcccaa
acactaataacactaccattagctacgttcatcttacaaggcacgttctcgtcaataccc
attgacctcgaacatcaagctagagttgatggtgcaaatttatttaataggttattttca
gtactcttaccactagcagcacctggtatagcagcagcattcctaatatcatggatgttc
tcatgggatgagtttacttatgcaatcctattaattccctatcactccacacttccagta
acaatataccaagacgttaccagaggaaacttattggcaggaatagcattttcactaata
ttcacacttcccgtaataattttaacttttgcattacaaaaatatctaagaggagaatat
ctagcaggggggataaaaggatga

DBGET integrated database retrieval system