KEGG   Saccharolobus solfataricus P2: SSO1003
Entry
SSO1003           CDS       T00054                                 

Definition
(GenBank) Sugar ABC transporter
  KO
K17314  trehalose transport system ATP-binding protein
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSO1003
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sso02000]
    SSO1003
Transporters [BR:sso02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Trehalose transporter
    SSO1003
SSDB
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA_29 Rad17 AAA_23
Other DBs
NCBI-ProteinID: AAK41273
UniProt: Q97ZC0
Position
859806..860780
AA seq 324 aa
MTVELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKII
ADGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLL
GISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQK
ELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPMNF
LPGELMKEKAQEIGFRPEWVEVGKGNLSCMVESVEASGESRYLICNFKNNNITILSQEFY
DVGQEVRFEIIKYRKYNDGRLVQE
NT seq 975 nt   +upstreamnt  +downstreamnt
atgacggtagaactaatagatattgtaaagaaatatggcaaaaacattgtaattaatggc
ataacagagaagatagagactggagagttctttgtaatactaggaccgagtggagaaggg
aaatcaacattattgaaaatcttggcaggaattgaaaaattagataagggaaaaattata
gcggatggagcagacattacagacaaacccccagagaagagaaatgttgctatggtattt
caaaactacgcactttacccaaacatgtcagtgagagataatatagcatttccactcaag
atgaggggaatgaaaaaagaggaaataatagaaagagtggaaaaagctgcaaagctttta
ggtatatcagaaatattagataaaaaagtaacacaaatcagtggagggcaacaacaaagg
gtcgcactggctagggcaattgtaagaaatccaagctatttcttgttggatgaaccatta
agtaatctagatgctagagtaaggacaacagctagaggagaattgaagagaatacaaaag
gaattgaaaggtacgttcatttatgtaacccacgatcaaaaggaagccttaagtctagca
gataggattgctatacttcataaaggcaaattcgaacaagtcagtgatccaaaaacactg
tatgaatatccaaaaacaaaatgggtggcgcaattcgtaggtgaattcccaatgaatttt
ctacctggtgaactaatgaaagaaaaggcgcaggaaatagggtttaggccagaatgggta
gaagtaggaaaaggcaatttatcttgtatggtagaatcagtagaagcttcaggggagtca
agatacttaatatgtaattttaaaaataataatataactatcctttctcaggaattttat
gatgtaggtcaagaagttaggtttgaaataattaaatatagaaaatataatgatggacga
ctggtacaagaatag

DBGET integrated database retrieval system