KEGG   Saccharolobus solfataricus P2: SSO1172Help
Entry
SSO1172           CDS       T00054                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
sso  Saccharolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 TcfC DUF3255
Motif
Other DBs
NCBI-ProteinID: AAK41420
UniProt: Q97YY0
Position
1011604..1014312
Genome map
AA seq 902 aa AA seqDB search
MIKIAILAMGNLPKTAKAFLTLFFLLSLISCSFLIPTSQSISVNFTVSSNGMVSIYIGGI
PWNNTVILHYGIENGPQQAWTNISNVVMKWNGQNFSATIGPFANGTWIGWVFYDNTTGQW
INYDNHPFWNWNLEVNPPNVGQTYATVLQNGSILITAIGRAPDQLDIHYGLTTGPQTGLP
WGNITDELMTYNPLWGNYTIIIGPFKPGQWVQWVYHDLTLNQWYHNTSGQNFAIQDVYSF
IQYINASYNRYVYVEGQPVSVIIYLQNTISQAINSSISIQIAGKLYNISSTLKPGYNLLS
LTLDTSQIPQGIYYPQLSIYVNNTLQRQATLPQLYVLNTTGKKPLSLVIVWNMHQPLYVA
PNGSWEQPWVWLHTGQDFYWDGSLVGAYELQALLIRQFNVSVTIDFTPVLLYQWETILHE
KNYSFTSNFGIIPNHDISAVNYTINLYRQLINEGKVDVLTVPFYHPLQPLLLQDGYWSDV
LAQIRMGENFTHEVFGVWANGTWTPEMAFDMDLVGLYNESNISYTILDQQAFLPYVTLVR
GSLNPDQPFIVENNLGQTIIVLFRNTTLSNEFGFKFFSQSPQLTAQELIQQLAEIYMNNP
GGVVTVALDGENPLIFNPNTGPADLYAIYQALSEYQGQWLITQTASEAIATHKPYSVITN
LLVNSWDLNLNYWNNGYLGKTEIWQNVSLAREYLVAYTAAVGANISPLVYLPLNETPNST
NLFDTLWNYLYVAEGSDWTWQTGPPAYGPLWFKEQALLYTSTIISEVKQQFDLIKLQSVK
LDGNNLKLGIYNGINTTVHLLLVITNGKQEIQLPIILSQGQNNFKIKISNVSGQLQIALY
SPISASQVGLTLIPINSYGFLVAQYQVNLNKSTSSMGTYLLALVGILVVSAIIVIVMKRG
HI
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaattgcaattttagccatgggtaatttgcctaaaacagcgaaggcattttta
actctattttttcttctaagtttaatttcttgttcattcctcattccaacatcacagtca
ataagcgtaaactttactgtgtcaagcaatggtatggtatccatttatattggaggtata
ccatggaataacaccgttattctacactacggaatagagaacggaccacaacaagcgtgg
actaacatctcaaacgttgtaatgaaatggaatgggcagaatttcagcgcaaccataggg
cctttcgctaatggaacctggataggttgggtgttttacgataatactactggacaatgg
ataaattacgataatcatccattctggaattggaatttagaggttaatcctccaaatgta
gggcaaacttacgctacagtgcttcaaaacggttcaatattaataactgcaataggaaga
gcaccagaccagctcgatatacattatgggctaactactggaccccaaacgggattacca
tggggtaatataactgatgaattgatgacttacaatccattatggggtaattatacgata
atcataggtccttttaagccaggccaatgggtacaatgggtctatcacgatctgactcta
aatcaatggtatcacaacacatctggtcaaaacttcgcaatacaagatgtttattcattc
attcaatacatcaatgcttcatataatagatatgtttacgttgagggtcagccagtaagt
gttataatatatctacagaacactatttcgcaagcgattaattcctcaatttcgattcag
atcgctggcaaattatacaatatctcctcaacgttaaaaccgggatataatctattatcc
ctaacactagatacctcccaaataccacaaggtatatactatccacaattaagcatttac
gtgaataatactcttcaaagacaagcaactctaccacaattatatgtcctaaacactact
ggaaagaagcccttaagtttagtaatagtctggaatatgcaccagcctctttatgtagct
ccaaatggtagttgggagcaaccttgggtatggttacacactgggcaagacttctactgg
gatggaagtttagtcggagcctatgaacttcaagcgttattgataagacagtttaacgtt
agcgtaacgatagatttcacacctgttctattatatcaatgggagacaatactgcacgag
aagaattatagctttacgtctaattttggaattattcccaatcatgatatatctgctgta
aattataccattaatctctataggcaattaattaatgagggtaaggtagatgtccttaca
gtgccattttatcatcctttacagccattgctacttcaagatggttattggagcgacgtc
ttagctcaaatcagaatgggtgagaatttcactcatgaagtttttggagtgtgggctaat
ggaacgtggactccggaaatggcatttgacatggatttagtaggactttataatgagagt
aatatatcctatactatacttgaccaacaagccttcttaccttacgttacattggttaga
ggttcgttgaacccagatcagccctttatcgtagagaataatctaggtcaaactattatt
gtactatttagaaacacaactttatctaacgaatttggttttaagttctttagccaatct
cctcagcttactgcacaagaacttatacaacaattggctgaaatatatatgaacaatcca
ggtggtgttgttacagttgctttagatggggagaatcctcttattttcaatccaaatact
ggcccagctgatctatacgcaatctatcaagctttatccgaatatcaagggcaatggcta
ataactcaaactgcaagtgaggcaatagctactcacaagccttacagtgtaataaccaat
ttacttgtgaattcatgggatcttaatctaaactattggaataatggataccttggaaag
actgaaatatggcaaaacgtttcgctagctagggaatatctagtagcttacactgcagct
gttggagccaacatttcaccattagtctatctacctttgaatgagacacctaattcaact
aatttatttgatacattatggaattacctatatgttgcagaaggtagtgattggacttgg
cagactggtcctccagcctatggtccattatggtttaaagaacaagcactgctctacact
tctacgataatttcagaggttaaacagcagtttgatctaataaaactacaaagtgtaaag
ttagatggaaataacttaaagctcggcatatataacggaatcaacactacggtacattta
ttactggtaattaccaacggtaagcaagaaatacaattacctataatattaagtcaagga
caaaacaactttaagataaaaatatctaatgtgtccggtcaacttcaaatagcactttat
tctcctatttctgcttcacaagtaggcttaacattaatacccattaatagttatggattc
ctagtagcccaatatcaagttaatctaaacaaatcaacaagttccatgggaacttacctg
ttggcgttagttggtatactagtagtgtcagcaataatagttatagtaatgaagaggggg
cacatttag

DBGET integrated database retrieval system