KEGG   Sulfolobus solfataricus P2: SSO1333Help
Entry
SSO1333           CDS       T00054                                 

Gene name
aceA_icl
Definition
(GenBank) Isocitrate lyase (aceA/icl)
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00630  Glyoxylate and dicarboxylate metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01200  Carbon metabolism
Module
sso_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SSO1333 (aceA_icl)
Enzymes [BR:sso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SSO1333 (aceA_icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAK41571
UniProt: Q97YI8
Position
complement(1168340..1169653)
Genome map
AA seq 437 aa AA seqDB search
MNIRDKWIEEEKSLEYEWSEDPRWRGIKRNYKPLDVVKLRGSIRIEYSLAKLASHKLWNL
LNTEPYVATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVKRLNNALIRADQISWSEGKHDIDYLLPIVADAEAGFGGPIHAFELTKALIEAGAAGVH
FEDQLAAEKKCGHLGGKVLIPISAFIRVLNAARLASDVLGVPTILIARTDALNAKYLSND
VDETDNQFLTGKRTSEGYYEIKGGIEYAIARGLAYAPYADLLWFETSKPDLEEARQFAEA
IHTHYPGKMLAYNLSPSFNWKKFMDDSKISKFMNELGEMGYKFQFITLAGWHLINYHTFK
LARAYRNEGMPAYVRLQELEFQAQAEGYTAVSHQREVGTDYFDLVLTIASGGEASTTAME
GSTEAEQFVEAKQKVLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgagataaatggattgaagaggagaaaagtctcgaatatgagtggtctgaa
gatccaaggtggagaggaataaagagaaattataagcccttggatgtggttaaattaaga
ggatctattagaattgagtatagtttagctaagttagcctctcacaaactttggaactta
ctaaatactgagccctatgtggcaacatttggggcattaacgggttcccaagcagtggaa
atggcaaaggcgggccttaaggctatttacgtaagtggatggcaagtagctgcagataac
aacttatcaaatcaaacttatccagacttaagcttatacccatctaacagcgttccaaac
ctagtaaagaggttaaataacgcccttataagggctgatcaaatatcttggagtgagggt
aaacatgatattgactatttactgcctattgttgcagatgctgaagctggttttggtggt
ccaattcacgccttcgaattaacaaaagccttaatagaggcaggggctgcaggggtacat
ttcgaagatcaattagcagcagagaagaagtgtggccatttaggagggaaagttctgatc
cctataagtgcatttataagagtactaaacgctgcaagactagcgtctgacgtattagga
gtaccaacaatactaatagcaaggacagacgcactgaatgctaaatacttatctaacgat
gtagatgagactgataatcaattcttaacaggaaagaggacatcagagggatattatgag
ataaagggtggtattgaatacgccatagctagaggattagcttatgcaccctatgctgac
ctattgtggtttgagacttctaagccagatttggaagaggctagacaatttgctgaggct
attcacactcattatccaggtaagatgttagcgtacaatttatccccctcatttaactgg
aagaaatttatggatgattctaaaattagcaagttcatgaacgaattgggagaaatgggc
tataaattccaattcattactcttgcaggttggcacttaattaactaccatacattcaaa
ttagcgagagcatatagaaatgaaggaatgccagcatatgtaagactacaagagttagag
ttccaagcacaagcagaaggctatactgcagtaagccaccagagagaggttggaacagat
tactttgacctagtgttaacaatagcgtctgggggagaagcgtccactactgcaatggaa
ggttccactgaagctgaacagtttgtagaggcaaaacagaaagtattaaaatag

DBGET integrated database retrieval system