KEGG   Sulfolobus solfataricus P2: SSO1529Help
Entry
SSO1529           CDS       T00054                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide S-acetyltransferase, amino-end (pdhC)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00010  Glycolysis / Gluconeogenesis
sso00020  Citrate cycle (TCA cycle)
sso00620  Pyruvate metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
Module
sso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO1529 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SSO1529 (pdhC)
   00620 Pyruvate metabolism
    SSO1529 (pdhC)
Enzymes [BR:sso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSO1529 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl E3_binding Biotin_lipoyl_2 2-oxoacid_dh HlyD_3 GCV_H RnfC_N DUF2118 Peptidase_M23 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AAK41751
UniProt: Q97Y20
Position
1380370..1381005
Genome map
AA seq 211 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTTVKSPVSGILLKIY
AKEGEEVPVGQIIAYIGEIGEQPPPSPTKPALATQQQQAQPIRTEEVKVIGEVRASPRAR
RLAKEKGIDLSKIRGTGPGGMITEDDVIRELENIEKGMKFTATGLRVKEVIPMSVIRQEI
SRRMVQSLQTMAQVTLSIEINANSLVKMKMK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaagtattaatgcctaagttaggcttaaccatgacaaaagggaaaatagtt
caatggaagaaaaaggaaggtgacagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactacagtaaaatcaccagttagtggtatcctacttaagatttac
gctaaggaaggtgaagaggtacccgttggtcaaataatagcgtacataggcgaaattgga
gaacaacctccaccctcacctactaaacccgctttagctactcaacaacaacaagcgcaa
ccaattcgaaccgaagaggtaaaggtaataggcgaagtaagagcttcacctagggctaga
agacttgccaaagaaaaaggaatagatctaagtaaaattagggggacaggaccaggcggt
atgataacggaagatgatgtaattagagagctggaaaatatcgaaaaaggaatgaaattc
accgcaactggtcttagggttaaagaagtgataccaatgagtgtaataagacaagaaata
agtagaagaatggttcagagccttcagacaatggcccaagtaacactaagtattgagatt
aatgcaaattcgttagttaaaatgaaaatgaaatag

DBGET integrated database retrieval system