KEGG   Saccharolobus solfataricus P2: SSO2213Help
Entry
SSO2213           CDS       T00054                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
sso  Saccharolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: AAK42383
UniProt: Q97WK3
Position
complement(2036095..2037138)
Genome map
AA seq 347 aa AA seqDB search
MIKAYFGAETFTLNKDFAYILVIGTTDVSLIPGLTIAGATPELTHFTPAADAEYVILGKC
KSINTIPVSPTGIPTPALLTRASLSFTKSLKIVVNAGSRITPKIPYIDLQGEPGKDIRKQ
ALSIEKVNIIIENGIKLGEELSNEYELIMIGESIPAGTTTAMATLLALGYDAMDKVSSAS
PDNPKELKRKVVEEALRNLPTDPLQRLAKVSDPVLLGVAGISLGFRGKILLAGGTQMTAA
AAIVNEFDKSKLKDIIIGTTKWIVEDKSADMLSLAKQVGVKVLASMLDLSISIHEGIRTY
EKGYVKEGVGAGGSTIMAFIRGVSNSTLVRKIDELYSELVGSNNLNT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggcatattttggagctgaaacttttaccctaaataaagatttcgcctatata
ttagtaataggaactactgacgtcagcctaattccagggttaaccatagctggggcaact
ccagaattaactcactttacacctgctgctgacgctgaatacgtgattctaggtaaatgt
aaaagcataaatactattccagttagtcctactggaataccaacacctgctttattaaca
agagcatcactatctttcacaaagtccttaaaaattgtagtaaatgcaggaagtagaata
acacctaagattccatatatagatcttcaaggtgagcctggaaaagatattagaaaacaa
gcactctccatagaaaaagtgaatattataattgaaaatggcatcaaattaggcgaagag
ctatctaatgaatacgaacttattatgattggagaatcaataccagctggtacaaccact
gcaatggctactcttttggcattaggttatgacgctatggataaagtgagttcagcatct
cctgataatccgaaggaattaaaaagaaaagttgtggaagaagcgttgaggaatttgcca
acagatcctttgcaaagattagctaaagtttctgatcccgtcctattgggcgtagctgga
atatctttaggatttagaggaaagattttattagctggagggactcaaatgacagctgct
gctgccatagttaatgaattcgataagagtaagttaaaagatattataattggtaccaca
aagtggatagtggaagataaatctgcggacatgttaagtttagcaaaacaagtaggagtt
aaggtactggcgagtatgttagatctttcaatttctattcatgaaggaataagaacgtac
gaaaaaggctatgttaaggagggggtaggagctggaggatcaacgataatggctttcatc
agaggagttagtaatagtacgttagtgagaaaaattgacgagttatatagtgaactagta
ggaagtaataatttaaatacctag

DBGET integrated database retrieval system