KEGG   Saccharolobus solfataricus P2: SSO2385
Entry
SSO2385           CDS       T00054                                 

Definition
(GenBank) GTP binding conserved hypothetical protein
  KO
K06944  uncharacterized protein
Organism
sso  Saccharolobus solfataricus P2
Brite
KEGG Orthology (KO) [BR:sso00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SSO2385
SSDB
Motif
Pfam: TGS MMR_HSR1_Xtn
Other DBs
NCBI-ProteinID: AAK42533
UniProt: Q97W55
Position
2171113..2172168
AA seq 351 aa
MVTNLPAEAKAKWLKVMDAKTPEEKFQALQEFLKEVPKHKGTENLVYWAKRRMAELREEM
EVRKSKKSGGFSLFVEKEGAGQAILIGDMLLRSFIMRKLTNVKQEFNELPVPGMVKYEDV
QIQLVNPPKSLPLSKTIGLIRNADEVIIAINNKEDLSLIKSLLEDNNILLRKPKGRVVIE
RTRYGISGIRVVNLGKLIGIDEKVVRDYIESFGIKSAIVKIIGEVTLDDIEKSMFEAVSY
KPTVVISKDRFDTGELPMLTIDQIDKLPKHLFDMLEVIRVYTKEPGEEPTKDPLILKKGS
TVLDVARKLHSSLAENFRYARVWGKSVKFQGQKVGPSHILEDRDIVEIHVK
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggtaacgaatttacctgccgaagctaaggctaagtggctaaaggtaatggacgcaaag
actccagaggagaagttccaagccctacaagaatttcttaaggaagttcctaagcacaag
gggactgaaaatttagtgtactgggcaaaaaggcgaatggccgagttaagagaagaaatg
gaggtaagaaagagcaagaaaagtggaggtttttcgttatttgttgagaaagagggtgca
ggccaagcgattttgataggagatatgcttcttagatcatttataatgagaaaacttact
aatgtaaaacaggaatttaatgagttaccagtgcctggtatggttaaatatgaggacgta
cagattcagttagttaatccacctaagagcctaccactctctaagacaataggtctaata
agaaatgcagatgaggttatcatagctataaataataaggaggatctatctcttataaag
agtctcctagaagataataatattctattaagaaaacctaagggaagggttgtaatagag
agaactagatatggaatttctggtattagagtagtaaatttaggtaaactgataggtatt
gatgagaaagtagttagggattatatagagagtttcggaattaaatcagcaatagtaaag
ataataggcgaggtcaccttagatgatatagaaaaatcaatgttcgaagctgttagctac
aagcctacagtagtgatctctaaggataggttcgacactggcgagttaccaatgttaact
atcgaccagatagataagttgcctaagcatttgttcgatatgttagaagtgatcagagtt
tacactaaagagcctggtgaagagccaactaaggatcctttaatactcaaaaaggggtct
acagttctagacgtggcaaggaaactgcattcgtcattggctgaaaattttaggtatgct
agagtctggggaaaatcggtaaagtttcaaggacagaaagtgggtccgtcacatattcta
gaagatagagatattgttgagatacatgtaaaatag

DBGET integrated database retrieval system