KEGG   Sulfolobus solfataricus P2: SSO2483Help
Entry
SSO2483           CDS       T00054                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit (sucC)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00020  Citrate cycle (TCA cycle)
sso00640  Propanoate metabolism
sso00660  C5-Branched dibasic acid metabolism
sso00720  Carbon fixation pathways in prokaryotes
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
Module
sso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSO2483 (sucC)
   00640 Propanoate metabolism
    SSO2483 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SSO2483 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO2483 (sucC)
Enzymes [BR:sso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SSO2483 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 PRY
Motif
Other DBs
NCBI-ProteinID: AAK42619
UniProt: Q97VX1
Position
complement(2254375..2255388)
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKSLFKRVGIPVPNGVVTSEPIRWQGKAVVKSQLLEGARGKRGLVRVTEDIYN
TILELKKLGVEKFLVEEFVPHEKEIYASVLLDRETAEPMLVLSREGGIDVEQAKDVKKMI
IPLERGVRSYDIVEAEKYLGVKGLGQIIQGLYKLFVDYDAELVEINPLALTNDGRILALD
SKVILEDNALYRHEDLLKELGRQEVRDSYVELEGDIGIIGNGAGLTMASMDLVKLNGGNP
ANFLDVGGGANREHVKESVLKVGSNPRVKKIVINIYGGITRCDEVALGIIDALKEVKKPI
FVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgaatatgagggaaagagtctttttaagcgtgtagggataccagtgcct
aatggtgttgtaacttctgaaccaataagatggcaaggaaaagctgtagtgaaatctcaa
ctattggaaggcgctagaggtaaaagaggattagtaagagtaactgaagacatttataat
actattttagaactgaaaaaactaggagtcgagaaattcttagtagaggaatttgttcct
cacgagaaggagatttacgcttcagtattgttagatagggaaactgcggaaccaatgtta
gttttatcaagagaaggaggcattgatgttgaacaagctaaggacgttaagaagatgata
ataccactagagaggggagttaggagttatgatattgttgaggctgagaagtatctagga
gttaagggattaggacaaataatacaaggtttatataaattatttgtagattacgacgct
gaactagttgagataaacccattagcattgactaatgatggtagaatattagctttagac
tctaaagtgattttagaggataacgcgttatatagacatgaggatttgttaaaggagtta
gggaggcaagaagttcgtgatagttatgtggaactagagggagatataggaataataggc
aatggtgcaggattaaccatggcttcaatggatctagttaaattaaatggcggaaatcca
gcaaatttcttggatgttggtggaggagctaatagggaacatgttaaagaaagtgttctc
aaagtgggtagcaatcctagagtcaaaaagattgttataaatatttacggtggaattact
agatgtgatgaggtagcgttaggtataattgatgcgctaaaggaggtgaagaagccaata
tttgttagattattaggaactaacgaggaattagggaagaaaatattaagagagaacggt
gtaaacgtatatgatgatgtattaaaaatgataggtgatgcagtacgctcataa

DBGET integrated database retrieval system