KEGG   Saccharolobus solfataricus P2: SSO2589Help
Entry
SSO2589           CDS       T00054                                 

Definition
(GenBank) Citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso00020  Citrate cycle (TCA cycle)
sso00630  Glyoxylate and dicarboxylate metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01200  Carbon metabolism
sso01210  2-Oxocarboxylic acid metabolism
sso01230  Biosynthesis of amino acids
Module
sso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sso_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sso_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSO2589
   00630 Glyoxylate and dicarboxylate metabolism
    SSO2589
Enzymes [BR:sso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SSO2589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: AAK42713
UniProt: P80148
Structure
PDB: 

Position
2356652..2357785
Genome map
AA seq 377 aa AA seqDB search
MSVVSKGLENVIIKVTNLTFIDGEKGILRYRGYNIEDLVNYGSYEETIYLMLYGKLPTKK
ELNDLKAKLNEEYEVPQEVLDTIYLMPKEADAIGLLEVGTAALASIDKNFKWKENDKEKA
ISIIAKMATLVANVYRRKEGNKPRIPEPSDSFAKSFLLASFAREPTTDEINAMDKALILY
TDHEVPASTTAALVAASTLSDMYSSLTAALAALKGPLHGGAAEEAFKQFIEIGDPNRVQN
WFNDKVVNQKNRLMGFGHRVYKTYDPRAKIFKKLALTLIERNADARRYFEIAQKLEELGI
KQFSSKGIYPNTDFYSGIVFYALGFPVYMFTALFALSRTLGWLAHIIEYVEEQHRLIRPR
ALYVGPEYQEYVSIDKR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcgtaagtaaaggtttggagaatgttattataaaggttacaaatttaacattc
atagatggggagaaaggaatactgaggtatagaggatataatattgaagatctagttaac
tatggcagttacgaagagactatctacttaatgctttatggaaaattacctacaaagaaa
gaattaaacgatttaaaggctaaacttaatgaggaatacgaggtacctcaggaagtttta
gacacaatataccttatgccgaaagaagcagacgcaataggtcttttagaagtaggaaca
gcagcattagcctctattgataagaactttaaatggaaggaaaacgataaagaaaaagca
attagcattattgctaaaatggctactctagtagcaaatgtatatagaagaaaggagggt
aataagccaagaattccagagccctcagatagttttgcaaaaagctttcttttagcgagt
ttcgctagggaacctactacagatgagataaacgcaatggataaggcgttaatactttat
actgatcatgaagtgccagcatcgacaacggcagcacttgttgcagcatccactttgtcg
gatatgtattcttcccttactgcagccttagctgcgttaaaaggtccattacatggtgga
gcagctgaagaggcttttaagcaattcattgaaataggtgatccaaatagagtacaaaac
tggtttaatgataaggtagtgaatcagaagaatagactaatgggatttggtcatagagtt
tacaagacttatgatcccagggcaaagatatttaagaaactagccttaacgctaattgaa
aggaatgctgatgcaaggagatattttgagatagctcaaaaacttgaggagttgggaatt
aagcaattttctagcaagggaatctatcctaacactgatttctattctggaatagtcttc
tacgctttaggatttccagtatacatgtttactgccttatttgccttatcgagaacttta
ggttggttagcacatataatagaatatgtagaggaacagcacagacttattagaccaaga
gccttatatgttggaccagaatatcaagagtatgtttctatagataaacgataa

DBGET integrated database retrieval system