KEGG   Saccharolobus solfataricus P2: SSO2651
Entry
SSO2651           CDS       T00054                                 

Gene name
pacS
Definition
(GenBank) Cation transporting ATPase (pacS)
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
sso  Saccharolobus solfataricus P2
Brite
Enzymes [BR:sso01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     SSO2651 (pacS)
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 HAD_2 HAD Hydrolase_6 DUF6286
Other DBs
NCBI-ProteinID: AAK42770
UniProt: Q97VH4
Position
complement(2409368..2411635)
AA seq 755 aa
MDLRECHMATEKKEELRITDNEEQLRIVGMHCATCVTTVSKSLKSVSGVKDAEVNLATGS
AKVILSGNVRLKELVKAVRKAGYDVATEKFTIKLNVNPEEMPKIERKFENVKGVVDVKSN
PGLGIVSVEYNPETTTPEEILKEAGVKGEIVNEQRSEKSILYKDFHDLLRRLAVGIIFTP
LTYLLPFFFGILVSIAVQFYSGLRFHKGAYRALKNKTTNMDVLVSLASNILWLSSIFLHN
TFYADASLLITFILVGKTLEAYIKAKMSAEIRIEPYKATLKDGRVVNSNELKVGDVVIVR
AGERIPADGIIENGEGEVNEAILTGEQKPVLKKKGDNVLAGGILVNGYLEVYVTRNWDRS
YIVQVTESVRGAYNTRVSIQNLVDKVSSIFVPIVISISALTFLVWKFVLDYNLYSSLLFS
VAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSIFEEMRNINVAILDKTGTVTEG
EYVIVSKKEFIEGALNLAAIAESRSIHPIAKAFHKMNVRAGEIEQFEEFPGRGIYARVNG
NDVIVGSKDFVRDNCNWNVEDEGDIFICINGNAGGIVNIRDKLRDDAKKVISYLKGRGIR
IIIATGDSSNYADEIGKELGVEVRKELTPDDKAELVKELRENGNKVMFIGDGINDSIAMR
EADIGIAISSGTDLAKSAGKVVVNSLDDIIGLFEQTELAVRKIKENLAWAFGYNTAIIPI
AAGVFYPFITLPPEYAALAMGFSSVIVSLWSLVPI
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggacctaagggaatgccacatggccactgagaagaaagaagagctaagaattacagat
aatgaggaacaactaagaatagttgggatgcattgtgcaacatgcgtaacaactgtctct
aaatctttgaagtcagttagtggtgtaaaagatgccgaagtaaatctagcaactgggagc
gcaaaagtaatcctaagtggtaatgtaagattaaaggaattagtaaaggccgtgagaaaa
gctggatatgatgttgcaacagagaagtttactataaaattgaatgttaacccagaggaa
atgcctaaaatagagaggaaattcgaaaacgttaagggggtagttgatgtaaagtccaat
ccaggtttaggaatagtgagcgtagagtacaatccagagaccactactccagaggagata
ttaaaggaagctggagttaagggggaaatagtaaatgaacaacgtagtgaaaagagtata
ctctataaggatttccatgacttattaaggagattggcagtaggtataatatttacacct
ttaacatatctacttccattcttttttggcatattggtatccatagcagtacagttttac
tcaggattaagatttcataaaggtgcgtatagggcattaaagaataaaactactaatatg
gatgtactagtctccttagcatcaaacatattgtggctctctagtattttccttcacaac
acattttacgccgacgcttcattattaataaccttcatacttgtgggtaaaacactagaa
gcgtatattaaagctaagatgagtgcagagatacgtatagaaccttataaagccactctg
aaagacggaagagtagttaactctaatgaactaaaagtaggcgatgtagtaattgttagg
gcgggagagagaataccagctgatggaataattgagaatggagaaggagaagtaaacgag
gctatacttactggagagcagaagccagtactgaagaaaaaaggagataacgtcctagct
ggtggtattttagtaaatggttacttagaagtatacgttactagaaactgggatagaagt
tatattgtacaagtaacagagagtgtaagaggggcttataatacaagagtttccatccaa
aatctagtggacaaagtttcctcaatatttgtgcctatagttattagcatctcagcactt
acgttcctagtttggaaatttgtcttggactataacctctattcttctctacttttcagt
gtagcagtattagctgcagcgtgtccttgtgcactagggttagcatcgcctatggcaatg
ttagttagtgttcggagagcattaaaaagaggtattataattagggatggtagtattttt
gaggaaatgagaaatatcaacgttgcaatcttggacaaaactggtactgtaactgagggt
gaatatgtaattgttagtaagaaggagttcattgaaggagcgttaaatttggctgcaatt
gcagaaagtagaagtatacatcctatcgctaaagcattccataaaatgaacgtaagagcg
ggagagattgagcagtttgaggagtttcctggaagaggaatatatgctagagtaaatggt
aacgatgtaattgtggggagtaaagatttcgtgagggacaattgtaactggaatgtcgaa
gatgaaggagatatttttatttgcattaatggaaatgctggagggatagttaacataagg
gataagctcagggatgatgccaaaaaggtaataagctatctgaaaggaaggggaattagg
ataataatagcaactggagatagtagtaattatgctgatgaaatagggaaggagttaggt
gttgaagttcgtaaggagttaactccagatgataaagcggagttggtgaaggaattaagg
gaaaatggcaataaagtaatgtttataggtgacggaataaatgattccatcgctatgaga
gaagctgacataggtatagctatttctagcggtactgatttggctaagagtgctggtaaa
gttgtggttaattcattagatgacataatagggttatttgagcaaactgaattggcagtt
agaaaaattaaggagaatttggcatgggcctttggctataatacagcaataatacctatt
gcagcaggagtattttacccattcataacgttaccaccggaatatgctgcacttgcgatg
ggatttagtagtgtgatagtgagtttatggtccctagtcccaatttag

DBGET integrated database retrieval system