KEGG   Saccharolobus solfataricus P2: SSO2847
Entry
SSO2847           CDS       T00054                                 
Name
(GenBank) Sugar-binding periplasmic protein
  KO
K10196  glucose/arabinose transport system substrate-binding protein
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSO2847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sso02000]
    SSO2847
Transporters [BR:sso02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glucose/arabinose transporter
    SSO2847
SSDB
Motif
Pfam: SBP_bac_1 Pilin_N Shisa
Other DBs
NCBI-ProteinID: AAK42957
UniProt: Q97UZ1
Position
complement(2606453..2608117)
AA seq 554 aa
MKRKYPYSLAKGLTSTQIAVIVAVIVIVIIIGVVAGFVLTKGPSTTAVTTTVTSTFTTTT
TIPSTTTSTPSNTVVFYTWWGGGDGGEALSQIIPAVKQYAGLQMQTYSIPGAGGTNAKYA
ILALIQAGKPPAAFQVHYGPEMISYVEAAPNGIHTFVNMTPYLIQWGLLNNAVYAVLQAG
AYNGTLLSVPINVHRGAVLYVNTQLLREYNLPFPYNFSTLVYDTVQLANHGVSPWIIPGG
DGGWDQFNVWEDIFLYLAGPQLYNELIYGTLNFSNPTVQKLINETNYWFLNFTSYNYPGW
QSMSWEQAFALIAQGKVAFQANGNWVTNYASYINVTVYPPLPQYISNSSVSVVETPFPGT
QHYYALVIDTIGIPVGPQEQQALQLAHFWSSYQGQEVWTKYKAVTYYKNGTDWYAQPAQW
YDYQQLINTSEQNFVYQLSDGGVFDDVFAQIDSGLLTLQQVGKVGLSAWNSTLVSSMQQE
QNEWLAAAKLGLGYLGFPGHPFAGYYPPWVTNPSAYGLTNNTQKTSNSVMLFLLPFLALP
LAIASIDNKYYLLK
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaaaaggaagtacccgtatagtctagctaagggattaacatctacccaaatagcagta
atagtagcagtaatcgtaatagtgataataataggagtagtagcaggtttcgttttaacc
aaggggccctctacaactgctgtaactactacagtaacaagcacgtttactacaactact
acaatacccagcacaaccacgtcaacccctagcaatacagtagtcttctatacatggtgg
ggtggaggtgatggaggggaagcactaagccagataatccctgcagttaagcaatatgcg
ggcttacaaatgcaaacatattctattccaggagctggaggtacaaatgcaaaatatgct
attttagcgcttatacaagctggtaaacctccagctgcatttcaggtacactatggacca
gaaatgataagttatgttgaggctgcgcccaatggtatacatacttttgtcaatatgact
ccttatttaatccaatggggactacttaataacgcggtttatgcagtattacaagctgga
gcttataatggtacattattatcagtaccaattaacgtacataggggagcagttctttat
gtcaacactcaattgttaagggaatataatttaccattcccctacaactttagtactctc
gtttatgatactgtacaactagctaatcacggtgtgagtccatggattatacctggtgga
gacggtggatgggatcaatttaacgtatgggaggatatattcttatatttagctgggcca
caactctacaatgaactaatatatggtacactgaacttcagcaatccaacggttcagaaa
ctaataaatgaaaccaactattggttcttgaacttcacaagctataactaccctggttgg
caatctatgtcatgggaacaagcatttgcactaatagctcaaggtaaagtcgcatttcaa
gccaatgggaactgggtaactaattacgcaagttatataaacgttacagtttatcctccg
ttacctcaatacataagcaactcaagtgtttctgtagtggaaactccattcccaggcaca
cagcactactatgctttagtgatagatacaattggtataccagtaggtcctcaagaacaa
caagctttacaactagcccatttctggtcttcataccaagggcaggaagtctggacaaaa
tacaaggcagtaacctattataaaaatggtacggattggtatgctcaaccagcacaatgg
tatgattatcagcaattaataaatacgtcagagcaaaacttcgtttatcaactatcagat
ggtggagtgtttgatgacgttttcgctcaaatagattcaggattactaactttacagcaa
gttggcaaggttggattatctgcttggaactctacgttagtatcttcaatgcaacaagaa
caaaatgaatggttagccgcagctaaattaggattaggatacttaggattccccggccat
ccttttgctggatactacccaccatgggttacaaatccatcagcatatggactaaccaat
aatacacaaaagacaagtaatagcgtaatgctcttcttactcccattcttagcgttaccc
cttgcaatagccagcatagacaataaatactatctcttgaagtaa

DBGET integrated database retrieval system