KEGG   Saccharolobus solfataricus P2: SSO2848
Entry
SSO2848           CDS       T00054                                 
Name
(GenBank) ABC transporter, permease (glucose)
  KO
K10197  glucose/arabinose transport system permease protein
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SSO2848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sso02000]
    SSO2848
Transporters [BR:sso02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glucose/arabinose transporter
    SSO2848
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AAK42958
UniProt: Q97UZ0
Position
2608309..2609169
AA seq 286 aa
MMKKGTIILVAPTAIFSAILLYLVIWNAVMSFMNWSLLNSKPTFVGLETYSIVIRTFQFT
NSLLHSIELSVILVVIGNILGIFIAALLYFLNSNKARSTFLSIVIYPLSISMAVNGLIWL
WLFNIHIGVDWLLVRIGLPQFPWLSSTSTMFPSLVLVSVWAYTGIAALFYLAGFMNIDKT
IVEAARLDGTSAFKILYKILIPNSLNSFIIATALLFLFSFRIFDLPYVLSGGTTNIFLQT
SELYMYYLFTVEYFSQATAVATMITLIATIIIIPYALTVIRRWIRR
NT seq 861 nt   +upstreamnt  +downstreamnt
ttgatgaagaagggtacaataatcttggttgctcccacagctattttttccgcaatacta
ttgtacctagtaatatggaatgcagtaatgtcattcatgaattggtccttgctgaactct
aaaccgacttttgtcgggcttgaaacttacagcatcgtaataagaacctttcagttcaca
aactctttattacactccatagagttgtcagtaattctagtagttattgggaatattctg
ggcatatttattgcagctttactatactttttaaattccaacaaggccaggtctactttt
ctctcaatagtaatataccctttatctatttccatggctgttaatggactcatttggctt
tggttatttaatattcatattggagtagactggcttttagtgaggattggtttacctcaa
tttccgtggctttcgtcaacctctacaatgtttcctagcttagttttggtctcagtttgg
gcatatactggaattgcggctctgttttatttagcagggtttatgaacatagataagact
atagtagaagcagctagattggatggaactagtgctttcaaaatactatacaagatactg
attccaaattcgttaaactcttttattatagccacggcccttctattcttgttctcattt
agaatatttgatctgccttatgtgttgtctggtggcactacgaatatttttcttcaaacg
agtgagttatacatgtattacctcttcactgtggagtatttctctcaagctacagcagtt
gctacgatgataacattaattgctacgataatcattattccgtatgccttaactgtcatt
aggaggtggataagaagatga

DBGET integrated database retrieval system