KEGG   Saccharolobus solfataricus P2: SSO3055
Entry
SSO3055           CDS       T00054                                 

Definition
(GenBank) Maltose ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sso00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SSO3055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sso02000]
    SSO3055
Transporters [BR:sso02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    SSO3055
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N RsgA_GTPase AAA_5 AAA_29 AAA_23 RNA_helicase AAA AAA_16 AAA_15 DUF87 PRK AAA_13 ABC_ATPase AAA_10 NACHT AAA_30 ATP-synt_ab ParA NTPase_1 SRP54
Other DBs
NCBI-ProteinID: AAK43155
UniProt: Q97UG5
Position
complement(2809610..2811463)
AA seq 617 aa
MEEIMDSLLKVNELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYG
LLKYPGVVLRGHVYLKDKDILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRA
AVSHGVNVEEARKLIKEKLELVDLPYNVVNMYPHELSGGMRQRVVIATSILLNPSLIILD
EPTTGLDVIVQYEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSK
EEIIKRPSHPYTYLLISSLPSLVKRREKLLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKC
STLNPALGDIMDGHKARCFLQKGGYVDLSTLPIPLEYYAEEKAETDLSESNQHEVVMKIL
NLSKIYYIRKNLILSEPINAVNDVSFELKKGTITALVGGSGHGKSTIAKILAGMIQQTSG
KIILLGKDVSEYGVRNSMWYKENVQMIFQDPYSSLDPRHTVRWHVERPLLIHKKVSNKDQ
LLPKIIEVLKNVGLKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADEPVSMLDA
SLRAGILNLIKKFKKNGISILYITHDIATVNYIADEIMVIYKGRIVEKGNTYEVISNPSH
EYTKRLIEAVPDPYKTI
NT seq 1854 nt   +upstreamnt  +downstreamnt
gtggaggagattatggatagtttactcaaggtaaatgaattaacagcaggttattttaat
caagatggatttgtaattggtgttactaacgttaattttgaggtatatccaaatgagatt
ttcgctatagcgggcgaatctggatgtgggaagtctacgttagcaatggcaatttacggc
ttacttaagtaccctggagtagtccttaggggccacgtttatttgaaagacaaagatatc
ttatcaattactcaggaagaactcagaaagcttagaatgaaagagttcgtgtatgtacct
cagtttgctatggatgcgttagatccagtagctaaaataggtgatcaaatgatgcgagct
gcggtaagtcatggagtaaatgtggaagaggcacgtaagttaataaaagagaaactggag
ttagtggatcttccttataatgtagttaatatgtatccgcatgagttatcaggcggtatg
aggcaaagagttgtaatagctacgtctattctcttaaacccctctttaataatactcgat
gagcctacaacaggactggacgttattgtccaatatgaaatacttaaggatctaaagaga
atacaaagacagttaggtgtttctttagtaattatatctcatgatatatcaatgttgttg
atgatatcggatagagtaggcataatgtatgctggtgagatagtagagattggatcaaag
gaggaaattataaaaaggccgtctcatccatatacataccttcttataagtagcctcccg
tctttggtaaagagacgagagaaattattatcaataccagggaatccaccacttatgcta
tcgaaagtacctaattcatgtaggttttatgatagatgtccattcaagatggaaaaatgt
agcactcttaacccagctttaggagatataatggatggtcataaggctaggtgtttccta
caaaaagggggatatgttgacttatctactcttcccataccgttagaatattatgctgag
gagaaggcagaaactgatttatcagagagcaatcaacatgaggttgtaatgaagatactg
aatttaagtaaaatttattatattagaaaaaaccttattttaagtgaacccatcaatgct
gttaatgatgtatcctttgagttaaagaagggcactataacagcattggtaggcggaagt
ggacatggtaagtctactatcgctaaaatactagctggtatgattcaacagacttctggt
aagataattctattaggaaaagatgtgagtgaatacggcgtgaggaactctatgtggtat
aaggagaacgttcagatgatattccaagatccttactcttcgcttgatcctcgtcatact
gttaggtggcacgtagagagacctttactcatacataaaaaggtttcaaataaagatcaa
ttattaccgaaaataattgaggttcttaaaaatgtaggattaaagccacccgagaaatat
ctatataaatatcctcatgagctatctggtggagaaaggcaaagggtggcaatagctaga
gcaactgctgtagaacctaaagtgttagttgctgatgaaccagtttccatgttagatgcc
tcgttgagggcaggcatattaaatctaattaagaagtttaaaaagaatggtatcagcata
ttatacataacccacgacattgcaactgtaaattatattgctgacgagattatggttatt
tataagggaaggatagtagaaaagggaaacacttatgaagttatatccaatccatctcat
gagtatactaaacgtttaatagaggcagtgccggatccatataaaactatctaa

DBGET integrated database retrieval system