KEGG   Saccharolobus solfataricus P2: SSO3058
Entry
SSO3058           CDS       T00054                                 

Definition
(GenBank) Maltose ABC transporter, permease
  KO
K02033  peptide/nickel transport system permease protein
Organism
sso  Saccharolobus solfataricus P2
Pathway
sso02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sso00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SSO3058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sso02000]
    SSO3058
Transporters [BR:sso02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    SSO3058
SSDB
Motif
Pfam: BPD_transp_1 VCPO_N
Other DBs
NCBI-ProteinID: AAK43157
UniProt: Q97UG4
Position
2812735..2813703
AA seq 322 aa
MATFFVVITVNFILPRLMPGSALAVVISLIEGQNGVAATAGSSAIALEVSQLEAAFGLTP
APWYVQYAHYIQGIFTLNLGASITYYPTPVLSIILSGLPWTLFLVVVGAIIAFFLGSYLG
SIAGFNRRSRKDLVILIITSILAALPSFVILMYLEMWLSVQHGIFLISFPSKINTSPNSI
MALSRFYTLPIIALMFTSLSGFVLGMRNNMLHTIRDNYVTYAEILGLDHNRIRKMVYKNS
LLPNITAFAIILGLAISQSLTVEGLLTTPGVGFFFGLALTSKDLPLLQGIFLFIAIMLIL
SIAIVEAIYTILDPRARVSESE
NT seq 969 nt   +upstreamnt  +downstreamnt
gtggccacattttttgtggtcataacagtaaacttcatattaccaagattaatgccagga
agcgctcttgctgtagtaatatccttaattgaaggacagaatggtgtcgctgctacagct
ggaagtagcgcgatagcccttgaagtaagccagcttgaagctgcatttggtttaactcct
gcaccatggtatgtacagtatgcgcattacatacaaggaatatttacgctaaacctagga
gccagcataacatattacccaactcctgtactctccataattttaagcggactaccttgg
acattatttctagtcgtagttggagcaatcatagccttcttccttggaagttatcttgga
agtatagccggttttaacagaagaagtagaaaagatttagtaatattaataattacatca
atcttggctgctttgccttcattcgttattttaatgtatttagaaatgtggttatccgtg
caacatggaatatttcttataagcttcccaagcaagattaatactagtcccaattcaatt
atggccctttcaagattttatacactcccaataatagcgttaatgtttacatcattatcg
ggatttgtgctgggaatgagaaataatatgctacatacgattagagataattatgtaact
tacgcagagattcttggattagatcataatcgaattagaaagatggtttacaaaaactca
ttgttaccaaatataaccgcctttgcaataatattgggtctcgcaataagccagtcactg
actgtagaaggtctattaacgacaccaggtgtgggattcttcttcgggttagcattaact
tcaaaggatttaccccttctccaagggattttcttatttatcgcaataatgttaatactt
tcaatagctatagtagaagcaatctacactattctagatcctagagcaagggtgagtgaa
agtgagtaa

DBGET integrated database retrieval system