KEGG   Saccharolobus solfataricus P2: SSO3256
Entry
SSO3256           CDS       T00054                                 

Definition
(GenBank) Second ORF in transposon ISC1316
  KO
K07496  putative transposase
Organism
sso  Saccharolobus solfataricus P2
Brite
KEGG Orthology (KO) [BR:sso00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    SSO3256
SSDB
Motif
Pfam: OrfB_IS605
Other DBs
NCBI-ProteinID: AAK41553
UniProt: Q97YK6
Position
1146950..1147540
AA seq 196 aa
MITSSRPFHLLGKVVAIDVGIEKLVTTSDGQYFPNLKPFERALTKVRELHRSLSRKRFLS
HNWFKAKVKLARVYEHVKNLRKDIYMKLGKYFAEYYDIVVMEDISVKKLVGKSLKVRRRL
HDVGFYEFRTILEYQLIKYGKKFQWCFTNFTQNDTISMEEKNIRAELEKSAYFNTRSKKF
SYLLKKLTENEFIYKE
NT seq 591 nt   +upstreamnt  +downstreamnt
ttgattacgagttcaaggcccttccatctacttggaaaagttgtcgcgatcgacgtggga
attgagaaactcgtaactacctccgatggtcagtatttccctaacctgaagccttttgag
agggccttaaccaaggtaagggaacttcataggtctctttcgaggaagagattcctctct
cataactggttcaaagctaaggttaagttggctagggtttatgagcacgtgaagaacttg
aggaaagatatttacatgaagctcggtaagtattttgcagaatactacgatatcgtggta
atggaggatattagcgttaagaagctggttggtaagtctctcaaggtgaggaggaggctt
cacgatgttggtttttacgagtttaggacgatactggagtatcaactaataaaatacggt
aagaagttccagtggtgtttcaccaattttactcaaaatgatacaatttctatggaagag
aaaaatatcagagcggagttagaaaaatcggcttatttcaacacaagaagcaaaaaattt
tcatatttgttgaagaaactaacagaaaacgagtttatatataaagagtaa

DBGET integrated database retrieval system