KEGG   Saccharolobus solfataricus SULA: SULA_0254Help
Entry
SULA_0254         CDS       T03910                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ssoa  Saccharolobus solfataricus SULA
Brite
KEGG Orthology (KO) [BR:ssoa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SULA_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKA78083
UniProt: A0A0E3KB42
Position
complement(223590..224576)
Genome map
AA seq 328 aa AA seqDB search
MAITIIISTQTVIEYILFIVGLVSCYVIGANNNATSLGILFATNAVKKRYAYILNMISIF
VGVVLGSLTMLHSVYGVVYGNSLYVIIAILTSLSSSIITFYYLNKSGIPSSLSQTFYPSI
AILTLISHGFVKLDWVKLWVIVSSWIISPIIAIGFSLLFYLMLNKVVSGEIRIIKQIAIY
RNLILFSSAFTSFIVGANAIGIIVSASLVTAPAYFVIPLYGLAAALGVLTSQRIAIRVGF
RITKLGYLGASSALIGSNVINEIFTILGIPLSITQTIVGGIIGLSFRSFTSDVKKQVMQI
FRSWSTSPIFAIVLSLAIFGVIKSILGL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcaataacaataataatttcgacacagaccgttattgaatacatattgtttattgtc
ggactagtatcatgttacgtgataggagccaacaataacgcgacatcactaggtatattg
tttgctactaatgccgtaaagaaaagatatgcttacattttgaatatgatttctatcttt
gtgggtgtagtgttaggcagtttaaccatgttacatagtgtttatggggtagtttatgga
aatagtttgtacgtcataatagctattttaacttcactatcatcatcgataataaccttt
tattatttaaataaatccggtattccttcctctttaagtcaaacgttctatccttcaatt
gctatactaaccttaatatcacatgggtttgtaaagttagattgggtaaaattatgggtg
atagtaagctcgtggatcatctcaccaataattgcgattggattttcccttctattttat
ttaatgctaaataaggttgtaagtggtgaaattcgtattataaaacagatcgctatatac
agaaatcttatactattctcatcagccttcacctcatttatcgtgggagccaatgcgata
ggcataatagtatctgcctcgttagtaacagccccagcatattttgtaatacccctttac
ggattagctgcagcgttaggagttttaactagtcaacgaatagcaataagggtaggattt
cgtataactaaattgggatatttgggtgcatcctcagcgttaataggaagtaatgttata
aatgaaattttcacgattctaggaataccactatcaattacccaaactatagtgggtggt
ataatagggcttagttttagaagctttacatcagatgttaaaaaacaagtgatgcaaata
ttcagaagttggtctacatccccaatttttgccatagtactctcattagcaatcttcgga
gtaataaagagtatattaggactttaa

DBGET integrated database retrieval system