KEGG   Streptococcus sobrinus: DK181_00595Help
Entry
DK181_00595       CDS       T05567                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ssob  Streptococcus sobrinus
Pathway
ssob03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ssob00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DK181_00595
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssob03011]
    DK181_00595
Ribosome [BR:ssob03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DK181_00595
  Bacteria
    DK181_00595
  Archaea
    DK181_00595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWN18040
Position
94234..94578
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAAGVVEKVLNSAIA
NAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtgcgtgtttcacctcgtaaa
acacgtcttgttcttgaccttattcgcggtaagaacgttgccgatgcaatcgcaatcttg
aaattcaccccaaacaaagctgctggtgtggttgaaaaagttttgaactcagcaatcgct
aacgcagaaaataactttggtttggaaaaagcaaacttggtcgtatctgaaacatttgca
aacgaaggaccaaccatgaaacggttccgtccacgtgccaaaggttcagcttcaccaatc
aacaaacgcacaacccacgtaactgtggttgtagcagaaaaataa

DBGET integrated database retrieval system